KEGG   Bacillus pseudofirmus: BpOF4_14805Help
Entry
BpOF4_14805       CDS       T01165                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bpf  Bacillus pseudofirmus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BpOF4_14805
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BpOF4_14805
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BpOF4_14805
Enzymes [BR:bpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BpOF4_14805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1374127..1375341
Genome map
AA seq 404 aa AA seqDB search
MRVRFSYVSHLYCPKCSAAYSADEKNNLCSCGSPLLVSYDYNSLKEKWQKEDLLHREPNL
WRYHELLPVKKKENIVSLGEGMTPLLSMGKLGEEYGITTLLMKDEGLIPTGSFKARGSAV
GVSKAKELGVEELAMPTNGNAGAAWSLYASRAGIKSHIVMPKDAPMITRQEVHVAGADLK
VIDGLISDAGKLVGEAVSEYGWFDVSTLKEPYRIEGKKTMGLEIAEQLNWELPDVILYPT
GGGVGLIGIYKALKELAEIGWIEKEKLPRLVAVQAEGCAPIVKAFEAGDKDSEFWNDSVT
AAFGINVPKALGDFLVLEAIYETNGCAIAVSDEHILQEQHHIAEREGAFICPEGAATFAA
AKKLRQDGWIKENETVICLNTGMGIKYPETVPMNVAVRSKTERL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagggtgcgttttagttatgtgagtcatttatattgtccgaaatgttctgcagcctat
tctgcagatgaaaaaaataatttgtgttcatgtggttcaccattactagtgagctatgat
tacaactcattaaaagaaaagtggcaaaaagaagatttactacatagagaacctaattta
tggcgttatcatgaattgctgccagtaaaaaagaaagagaacatcgtttctttaggagaa
ggaatgactccattactatctatgggtaagctcggtgaagagtatggaattacaacatta
ttgatgaaagatgaagggttaatcccaaccggttcgtttaaagcaagaggttcagcagtt
ggtgtttctaaagcaaaagaacttggtgtagaagagcttgctatgcctacaaacggtaat
gcaggagcagcttggtcattgtatgcttcgagagcaggaattaaaagccatatcgttatg
ccaaaagatgccccgatgattacgagacaagaggttcatgtggctggtgctgatttgaaa
gtgattgacggtttaattagtgacgcaggtaaattagtaggggaagctgtaagtgaatat
ggctggtttgatgtttcaacattaaaagagccttaccggattgaaggtaaaaaaacaatg
gggcttgaaattgcagaacaattgaattgggaactccctgatgtgattttgtacccaact
ggagggggagtcggcttaatcggaatatacaaagcacttaaggaattagccgaaattggt
tggattgaaaaagaaaagcttcctaggcttgtagcagttcaggcagagggatgtgcacca
attgttaaagcatttgaagcaggagataaagattctgaattttggaatgactctgtaact
gcagcttttggaataaatgtgcctaaagcacttggtgactttctagttcttgaagcgatc
tatgagacaaatggttgtgcaattgcagtgtcagatgaacatattttacaagagcagcat
catattgccgaaagagaaggagcatttatttgtccggaaggggctgcaacatttgcggct
gcaaaaaaattacgtcaagatggatggattaaagaaaatgaaaccgtcatatgcttaaac
acaggcatgggaatcaagtatcccgagacggttccgatgaatgtggctgtccgctcaaaa
acagaacgattatag

DBGET integrated database retrieval system