KEGG   Bacillus pseudofirmus: BpOF4_14805Help
Entry
BpOF4_14805       CDS       T01165                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bpf  Bacillus pseudofirmus
Pathway
bpf00260  Glycine, serine and threonine metabolism
bpf00750  Vitamin B6 metabolism
bpf01100  Metabolic pathways
bpf01110  Biosynthesis of secondary metabolites
bpf01120  Microbial metabolism in diverse environments
bpf01230  Biosynthesis of amino acids
Module
bpf_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BpOF4_14805
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BpOF4_14805
Enzymes [BR:bpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BpOF4_14805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADC51010
UniProt: D3FZE1
Position
1374127..1375341
Genome map
AA seq 404 aa AA seqDB search
MRVRFSYVSHLYCPKCSAAYSADEKNNLCSCGSPLLVSYDYNSLKEKWQKEDLLHREPNL
WRYHELLPVKKKENIVSLGEGMTPLLSMGKLGEEYGITTLLMKDEGLIPTGSFKARGSAV
GVSKAKELGVEELAMPTNGNAGAAWSLYASRAGIKSHIVMPKDAPMITRQEVHVAGADLK
VIDGLISDAGKLVGEAVSEYGWFDVSTLKEPYRIEGKKTMGLEIAEQLNWELPDVILYPT
GGGVGLIGIYKALKELAEIGWIEKEKLPRLVAVQAEGCAPIVKAFEAGDKDSEFWNDSVT
AAFGINVPKALGDFLVLEAIYETNGCAIAVSDEHILQEQHHIAEREGAFICPEGAATFAA
AKKLRQDGWIKENETVICLNTGMGIKYPETVPMNVAVRSKTERL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagggtgcgttttagttatgtgagtcatttatattgtccgaaatgttctgcagcctat
tctgcagatgaaaaaaataatttgtgttcatgtggttcaccattactagtgagctatgat
tacaactcattaaaagaaaagtggcaaaaagaagatttactacatagagaacctaattta
tggcgttatcatgaattgctgccagtaaaaaagaaagagaacatcgtttctttaggagaa
ggaatgactccattactatctatgggtaagctcggtgaagagtatggaattacaacatta
ttgatgaaagatgaagggttaatcccaaccggttcgtttaaagcaagaggttcagcagtt
ggtgtttctaaagcaaaagaacttggtgtagaagagcttgctatgcctacaaacggtaat
gcaggagcagcttggtcattgtatgcttcgagagcaggaattaaaagccatatcgttatg
ccaaaagatgccccgatgattacgagacaagaggttcatgtggctggtgctgatttgaaa
gtgattgacggtttaattagtgacgcaggtaaattagtaggggaagctgtaagtgaatat
ggctggtttgatgtttcaacattaaaagagccttaccggattgaaggtaaaaaaacaatg
gggcttgaaattgcagaacaattgaattgggaactccctgatgtgattttgtacccaact
ggagggggagtcggcttaatcggaatatacaaagcacttaaggaattagccgaaattggt
tggattgaaaaagaaaagcttcctaggcttgtagcagttcaggcagagggatgtgcacca
attgttaaagcatttgaagcaggagataaagattctgaattttggaatgactctgtaact
gcagcttttggaataaatgtgcctaaagcacttggtgactttctagttcttgaagcgatc
tatgagacaaatggttgtgcaattgcagtgtcagatgaacatattttacaagagcagcat
catattgccgaaagagaaggagcatttatttgtccggaaggggctgcaacatttgcggct
gcaaaaaaattacgtcaagatggatggattaaagaaaatgaaaccgtcatatgcttaaac
acaggcatgggaatcaagtatcccgagacggttccgatgaatgtggctgtccgctcaaaa
acagaacgattatag

DBGET integrated database retrieval system