KEGG   Bacillus pseudofirmus: BpOF4_15465Help
Entry
BpOF4_15465       CDS       T01165                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bpf  Bacillus pseudofirmus
Pathway
bpf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpf01100  Metabolic pathways
bpf01110  Biosynthesis of secondary metabolites
bpf01130  Biosynthesis of antibiotics
bpf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BpOF4_15465 (trpC)
Enzymes [BR:bpf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BpOF4_15465 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG
Motif
Other DBs
NCBI-ProteinID: ADC51142
UniProt: D3G0I0
Position
1496018..1496791
Genome map
AA seq 257 aa AA seqDB search
MLNQIIETKRTEIKNLVQPSFVNVQKKSLYQALSKPNRSIGLIAEVKKASPSKGIIKEDF
NPLEIALGYEVGGADALSVLTDQPYFKGHRDYLSAIKQQVNLPVLRKDFIIDPVQIEESV
RMGADAILLIAGVVPNIELKKLYEEAVGAGLECLVEVHAKEELESLLHEFTPSIIGVNNR
NLKTFTTDLSQTETIGSLVPRDSLFVSESGIHVTEDLERVKNAGAHAVLVGESLMRAESP
AEGIDSLYGGEHIAATR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatcaaattattgaaacaaaacgaacggaaataaaaaacctagtacagccgtct
tttgtaaatgttcaaaagaaatcactgtatcaagcattatcaaaaccaaatcgttcgatc
gggctaattgctgaagtgaaaaaagcctctccttctaaaggcatcataaaggaagatttc
aatcctttagaaattgctctagggtatgaagtcggaggggcagatgccctttctgtgtta
acggatcaaccctattttaaaggacacagagactatctatctgccattaagcagcaagta
aatctgcctgttttgcgtaaagactttattatcgatccagtgcaaatagaagaaagtgta
cgaatgggtgcagatgcgattttgttgattgcaggtgtagtgccaaacattgagttgaaa
aagttatacgaggaggcagttggtgccggtcttgaatgtttagttgaggtgcatgcaaaa
gaagagcttgagtcattgcttcacgaatttaccccttcaatcatcggggtgaacaatcga
aatttaaaaacatttacaaccgacctttctcaaacagaaacgatcgggagcctcgttcca
cgtgacagtttatttgtaagcgaaagcggaattcatgtaaccgaagatttagaaagagtg
aaaaacgcaggagcacatgccgttttagtaggagaatctctgatgagagctgaatctcct
gccgaaggaattgattctttatatggcggtgagcacattgcggccactcgttaa

DBGET integrated database retrieval system