KEGG   Bacillus pseudofirmus: BpOF4_15475Help
Entry
BpOF4_15475       CDS       T01165                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpf  Bacillus pseudofirmus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BpOF4_15475 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BpOF4_15475 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BpOF4_15475 (trpB)
Enzymes [BR:bpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BpOF4_15475 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1497406..1498614
Genome map
AA seq 402 aa AA seqDB search
MQTTTSVYPDKRGRFGEFGGKYVPETLMSAIEELEQALDEAMASDEFEKEYVDHLREFAG
RPTALTYAKNISEKLGGAKIYLKREDLVHTGAHKLNNAIGQALLAKRMGKTKIVAETGAG
QHGVATATIAARFGLSCKVFMGAEDMERQALNVFRMELLGAEVIPATSGSQTLKDATNEA
IRYWVTHAEDTFYLIGSVVGPHPYPKMVRDFQRIIGDEAKEQFTARESRLPDEIIACVGG
GSNAIGTFYPFIEDDVRLIGVEAAGKGVDTDQHAATITHGKKGVIHGSLTYLLQDEAGQI
TEPYSISAGLDYPGVGPEHAHLASTGRVQYEAVTDQQALDALRLLSVEEGIIPAVESAHA
LAKAFERAGKLTPNDTILVCLSGRGDKDVHTLMKHFKGGDES
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaacaacaacgagcgtgtatccagataaaagaggacgttttggagagtttggcggg
aagtacgttccggaaacattaatgagtgcaattgaggaattagaacaagctcttgatgag
gctatggccagtgatgagtttgaaaaagaatacgtagaccatctgcgtgagtttgctggc
agaccaactgcattaacctatgctaaaaatatttctgaaaaactaggcggtgcgaaaatc
tatctaaaaagagaagatttagtacataccggtgctcataagttaaataatgcgattggt
caagcactgcttgcaaaacgaatggggaaaacaaagattgtagcagaaacgggagcaggc
cagcatggtgttgccacagctacgattgctgcaagattcggattatcctgtaaagttttt
atgggagcagaggatatggaacgtcaagcattaaatgtattccgcatggagctgcttgga
gcagaagtcattcctgctacatccggaagccaaacgttaaaagatgcgacaaatgaagca
atcaggtactgggtcacacatgcagaagataccttttatttgattggctcggttgttggt
ccgcatccatatccgaagatggtaagagattttcagcggattattggagacgaagcgaaa
gagcagtttaccgcacgtgagtcgagacttcctgatgagattattgcctgcgtcggcgga
gggagtaatgcgattggcacattttacccttttattgaagatgatgtgcgattaatcggg
gttgaagctgctggaaaaggagtggataccgatcaacatgcagccacgattacacacggg
aaaaaaggggttattcacggttcactaacgtatctgcttcaagatgaagcagggcagatc
accgagccttattcgatttctgcaggacttgattatcctggtgtaggtcctgagcatgcg
catttagcaagcactggccgtgttcagtacgaagctgtaaccgatcaacaagcgctcgat
gcccttagactcttatctgttgaggaagggattattccggctgttgaatcagcacacgcc
ctggcaaaggcgtttgagcgtgcgggaaaattaacaccaaatgatacgattttagtttgt
ttatcaggcagaggagataaagatgttcatacattaatgaagcattttaaaggaggggat
gagtcatga

DBGET integrated database retrieval system