KEGG   Bacillus pseudofirmus: BpOF4_15480Help
Entry
BpOF4_15480       CDS       T01165                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bpf  Bacillus pseudofirmus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BpOF4_15480 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BpOF4_15480 (trpA)
Enzymes [BR:bpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BpOF4_15480 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1498611..1499411
Genome map
AA seq 266 aa AA seqDB search
MNQRMNQLKEKNDGLFIPFITAGDPTPEATIDIALMLEEAGADLLELGIPYSDPLADGPT
IQEASKRALAGGMTLEGAMKLVPLMRERGLTIPVVVFTYFNPLLQFGEKRFTELAGDMGI
DGILVPDLPYEESDDLNTLCNKQGLSMISLVAPTSNARIKKIASRAEGFLYCVSSLGVTG
ERKKIDDRVYDFLETVKQASPVPVAVGFGISSNEQVKEMQQHADGVIVGSALVREIAKHE
DLLKDEKNRKDGLFQLKTFVTSLISS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcggatgaatcaactaaaagaaaaaaatgacggtctctttattccctttatt
acagcaggggacccaactcctgaagctacaattgatatcgcgttgatgttagaagaagca
ggtgctgacttactggaactcgggattccttactctgacccgctagcagatggtccgacg
atccaagaggcatctaagcgagcattagctggcggaatgacacttgaaggggcgatgaag
cttgttcctcttatgagagagcgagggttaacgattccagttgttgtgtttacgtacttt
aacccgcttctgcaatttggggaaaagcgctttacggagttggcaggggatatggggatt
gatggtattttggttccggatctgccttatgaagaaagtgacgatttgaacaccctttgc
aataagcaaggtttatcaatgatctcacttgtagcacctacatccaatgccagaattaaa
aaaattgcgagccgtgcagaagggtttttatactgtgtttcttcactaggcgtgacaggt
gagagaaagaaaattgatgatagagtatatgactttttggaaacagtaaaacaagcaagc
ccggttccggtagccgtaggttttggaatttcatctaatgaacaagtcaaagaaatgcag
cagcatgctgatggtgtcattgtagggagtgctcttgtacgtgagatcgcgaagcatgaa
gacttactgaaagatgaaaaaaacagaaaagatggactatttcaattaaaaacgtttgtc
acctcgctcatttcatcgtaa

DBGET integrated database retrieval system