KEGG   Bacillus pseudofirmus: BpOF4_15650Help
Entry
BpOF4_15650       CDS       T01165                                 

Gene name
aspB
Definition
aspartate aminotransferase (EC:2.6.1.1)
Orthology
K00812  
aspartate aminotransferase [EC:2.6.1.1]
Organism
bpf  Bacillus pseudofirmus
Pathway
Alanine, aspartate and glutamate metabolism
Cysteine and methionine metabolism
Arginine and proline metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    BpOF4_15650 (aspB)
   01230 Biosynthesis of amino acids
    BpOF4_15650 (aspB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BpOF4_15650 (aspB)
   00270 Cysteine and methionine metabolism
    BpOF4_15650 (aspB)
   00330 Arginine and proline metabolism
    BpOF4_15650 (aspB)
   00350 Tyrosine metabolism
    BpOF4_15650 (aspB)
   00360 Phenylalanine metabolism
    BpOF4_15650 (aspB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BpOF4_15650 (aspB)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    BpOF4_15650 (aspB)
Enzymes [BR:bpf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     BpOF4_15650 (aspB)
Amino acid related enzymes [BR:bpf01007]
 Aminotransferase (transaminase)
  Class I
   BpOF4_15650 (aspB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1529104..1530288
Genome map
AA seq 394 aa AA seqDB search
MKLAQRVSALTPSTTLAITAKAKELKEQGHDVIGLGAGEPDFNTPQYIIDAAVRSMEEGH
TKYTPSGGLPALKKAVIEKFKEDQGLDYAPSEIIVGTGAKHILYTLFQALLDEADEVIIP
TPYWVSYPEQVKLAGGEPVYVEGLESNDFKITAEQLEAVITPKTKAVIINSPSNPTGSLY
SKEELKQLGDVCLKHDILIVSDEIYEKLVYGEVTHTSIAEVSDELKRQTVVVNGVSKSHS
MTGWRIGYAAGPAELIKAMTNLASHSTSNPTTSAQYGAIAAYTEDDGSVEVMRSAFEDRL
NKVYEKLVAIPGVSCVKPKGAFYLFPNVSEAAKLNGYDDVDKWVEALLAEEKVALVPGSG
FGAPHNVRLSYATSLEALEEALIRIERFVRAKTK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcacaaagagtttctgcattaacaccatcgacaacactagccattactgca
aaagcaaaagaactaaaagaacaaggacatgatgtcattggtctaggagcgggtgagcct
gactttaatacgccacagtacataatcgatgcagcggttcgctccatggaagaagggcac
acaaaatatacgccatcaggcggtctgcctgctttaaaaaaagctgttattgaaaagttt
aaagaagaccaaggcttagattatgcaccgagtgaaattattgtaggaactggtgctaaa
catattctttacacgttgttccaggcacttttagacgaagcggatgaagttattattcct
acaccttattgggtgagctatcctgaacaagtgaaacttgcaggcggtgaaccagtctat
gtagagggacttgaaagtaatgattttaaaataacggcagagcagttagaagcagttatt
acaccgaaaacaaaagcggttattattaactctccatcaaacccaacaggctctctttat
tcaaaagaggaattaaagcagcttggagatgtttgcttaaagcatgacattctaattgta
tctgatgaaatttatgagaagcttgtttatggtgaagtaactcatacatcgattgctgaa
gtttctgatgagttgaagagacaaacggttgttgtaaatggggtttctaaatcacattct
atgacagggtggagaattggctatgcagcaggtcctgcagaacttattaaagcgatgacg
aacctagcaagccatagcacatcaaatcctacaacaagtgcacaatacggtgcgatcgcg
gcttacacagaggatgatggttctgtagaagtgatgcgttctgcttttgaagaccgttta
aacaaagtgtatgaaaagcttgttgccatccctggagtgtcttgtgtgaaacctaaagga
gcattttacctctttccaaatgtaagcgaggcggctaagttaaatgggtatgacgatgtc
gataagtgggtagaagccttattagcagaagaaaaagtagcattagttcctggttctggc
tttggagcaccacataatgtccgcttatcgtatgcgacctcacttgaagctttagaagaa
gcattaattcgtattgagcgatttgttcgcgcaaaaacaaaataa

DBGET integrated database retrieval system