KEGG   Bacillus pseudofirmus: BpOF4_15650Help
Entry
BpOF4_15650       CDS       T01165                                 

Gene name
aspB
Definition
aspartate aminotransferase (EC:2.6.1.1)
Orthology
K00812  
aspartate aminotransferase [EC:2.6.1.1]
Organism
bpf  Bacillus pseudofirmus
Pathway
Alanine, aspartate and glutamate metabolism
Cysteine and methionine metabolism
Arginine and proline metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:bpf01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpf01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bpf00250]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bpf00270]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpf00330]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bpf00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:bpf00360]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bpf00400]
Metabolism; Biosynthesis of other secondary metabolites; Novobiocin biosynthesis [PATH:bpf00401]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1529104..1530288
Genome map
AA seq 394 aa AA seqDB search
MKLAQRVSALTPSTTLAITAKAKELKEQGHDVIGLGAGEPDFNTPQYIIDAAVRSMEEGH
TKYTPSGGLPALKKAVIEKFKEDQGLDYAPSEIIVGTGAKHILYTLFQALLDEADEVIIP
TPYWVSYPEQVKLAGGEPVYVEGLESNDFKITAEQLEAVITPKTKAVIINSPSNPTGSLY
SKEELKQLGDVCLKHDILIVSDEIYEKLVYGEVTHTSIAEVSDELKRQTVVVNGVSKSHS
MTGWRIGYAAGPAELIKAMTNLASHSTSNPTTSAQYGAIAAYTEDDGSVEVMRSAFEDRL
NKVYEKLVAIPGVSCVKPKGAFYLFPNVSEAAKLNGYDDVDKWVEALLAEEKVALVPGSG
FGAPHNVRLSYATSLEALEEALIRIERFVRAKTK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcacaaagagtttctgcattaacaccatcgacaacactagccattactgca
aaagcaaaagaactaaaagaacaaggacatgatgtcattggtctaggagcgggtgagcct
gactttaatacgccacagtacataatcgatgcagcggttcgctccatggaagaagggcac
acaaaatatacgccatcaggcggtctgcctgctttaaaaaaagctgttattgaaaagttt
aaagaagaccaaggcttagattatgcaccgagtgaaattattgtaggaactggtgctaaa
catattctttacacgttgttccaggcacttttagacgaagcggatgaagttattattcct
acaccttattgggtgagctatcctgaacaagtgaaacttgcaggcggtgaaccagtctat
gtagagggacttgaaagtaatgattttaaaataacggcagagcagttagaagcagttatt
acaccgaaaacaaaagcggttattattaactctccatcaaacccaacaggctctctttat
tcaaaagaggaattaaagcagcttggagatgtttgcttaaagcatgacattctaattgta
tctgatgaaatttatgagaagcttgtttatggtgaagtaactcatacatcgattgctgaa
gtttctgatgagttgaagagacaaacggttgttgtaaatggggtttctaaatcacattct
atgacagggtggagaattggctatgcagcaggtcctgcagaacttattaaagcgatgacg
aacctagcaagccatagcacatcaaatcctacaacaagtgcacaatacggtgcgatcgcg
gcttacacagaggatgatggttctgtagaagtgatgcgttctgcttttgaagaccgttta
aacaaagtgtatgaaaagcttgttgccatccctggagtgtcttgtgtgaaacctaaagga
gcattttacctctttccaaatgtaagcgaggcggctaagttaaatgggtatgacgatgtc
gataagtgggtagaagccttattagcagaagaaaaagtagcattagttcctggttctggc
tttggagcaccacataatgtccgcttatcgtatgcgacctcacttgaagctttagaagaa
gcattaattcgtattgagcgatttgttcgcgcaaaaacaaaataa

DBGET integrated database retrieval system