KEGG   Bacillus pseudofirmus: BpOF4_15650Help
Entry
BpOF4_15650       CDS       T01165                                 

Gene name
aspB
Definition
(GenBank) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
bpf  Bacillus pseudofirmus
Pathway
bpf00220  Arginine biosynthesis
bpf00250  Alanine, aspartate and glutamate metabolism
bpf00270  Cysteine and methionine metabolism
bpf00330  Arginine and proline metabolism
bpf00350  Tyrosine metabolism
bpf00360  Phenylalanine metabolism
bpf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpf00401  Novobiocin biosynthesis
bpf01100  Metabolic pathways
bpf01110  Biosynthesis of secondary metabolites
bpf01130  Biosynthesis of antibiotics
bpf01210  2-Oxocarboxylic acid metabolism
bpf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BpOF4_15650 (aspB)
   00270 Cysteine and methionine metabolism
    BpOF4_15650 (aspB)
   00220 Arginine biosynthesis
    BpOF4_15650 (aspB)
   00330 Arginine and proline metabolism
    BpOF4_15650 (aspB)
   00350 Tyrosine metabolism
    BpOF4_15650 (aspB)
   00360 Phenylalanine metabolism
    BpOF4_15650 (aspB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BpOF4_15650 (aspB)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    BpOF4_15650 (aspB)
Enzymes [BR:bpf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     BpOF4_15650 (aspB)
Amino acid related enzymes [BR:bpf01007]
 Aminotransferase (transaminase)
  Class I
   BpOF4_15650 (aspB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP Radical_SAM Aminotran_3 Alliinase_C
Motif
Other DBs
NCBI-ProteinID: ADC51179
UniProt: D3G0L7
Position
1529104..1530288
Genome map
AA seq 394 aa AA seqDB search
MKLAQRVSALTPSTTLAITAKAKELKEQGHDVIGLGAGEPDFNTPQYIIDAAVRSMEEGH
TKYTPSGGLPALKKAVIEKFKEDQGLDYAPSEIIVGTGAKHILYTLFQALLDEADEVIIP
TPYWVSYPEQVKLAGGEPVYVEGLESNDFKITAEQLEAVITPKTKAVIINSPSNPTGSLY
SKEELKQLGDVCLKHDILIVSDEIYEKLVYGEVTHTSIAEVSDELKRQTVVVNGVSKSHS
MTGWRIGYAAGPAELIKAMTNLASHSTSNPTTSAQYGAIAAYTEDDGSVEVMRSAFEDRL
NKVYEKLVAIPGVSCVKPKGAFYLFPNVSEAAKLNGYDDVDKWVEALLAEEKVALVPGSG
FGAPHNVRLSYATSLEALEEALIRIERFVRAKTK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcacaaagagtttctgcattaacaccatcgacaacactagccattactgca
aaagcaaaagaactaaaagaacaaggacatgatgtcattggtctaggagcgggtgagcct
gactttaatacgccacagtacataatcgatgcagcggttcgctccatggaagaagggcac
acaaaatatacgccatcaggcggtctgcctgctttaaaaaaagctgttattgaaaagttt
aaagaagaccaaggcttagattatgcaccgagtgaaattattgtaggaactggtgctaaa
catattctttacacgttgttccaggcacttttagacgaagcggatgaagttattattcct
acaccttattgggtgagctatcctgaacaagtgaaacttgcaggcggtgaaccagtctat
gtagagggacttgaaagtaatgattttaaaataacggcagagcagttagaagcagttatt
acaccgaaaacaaaagcggttattattaactctccatcaaacccaacaggctctctttat
tcaaaagaggaattaaagcagcttggagatgtttgcttaaagcatgacattctaattgta
tctgatgaaatttatgagaagcttgtttatggtgaagtaactcatacatcgattgctgaa
gtttctgatgagttgaagagacaaacggttgttgtaaatggggtttctaaatcacattct
atgacagggtggagaattggctatgcagcaggtcctgcagaacttattaaagcgatgacg
aacctagcaagccatagcacatcaaatcctacaacaagtgcacaatacggtgcgatcgcg
gcttacacagaggatgatggttctgtagaagtgatgcgttctgcttttgaagaccgttta
aacaaagtgtatgaaaagcttgttgccatccctggagtgtcttgtgtgaaacctaaagga
gcattttacctctttccaaatgtaagcgaggcggctaagttaaatgggtatgacgatgtc
gataagtgggtagaagccttattagcagaagaaaaagtagcattagttcctggttctggc
tttggagcaccacataatgtccgcttatcgtatgcgacctcacttgaagctttagaagaa
gcattaattcgtattgagcgatttgttcgcgcaaaaacaaaataa

DBGET integrated database retrieval system