KEGG   Bathycoccus prasinos: Bathy06g03330Help
Entry
Bathy06g03330     CDS       T03089                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bpg  Bathycoccus prasinos
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bpg00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Bathy06g03330
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Bathy06g03330
Enzymes [BR:bpg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Bathy06g03330
Lipid biosynthesis proteins [BR:bpg01004]
 Desaturase
  First
   Bathy06g03330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:619500..620546
Genome map
AA seq 348 aa AA seqDB search
MPEDSSNEKKTLLTSWQRIGQEGVQKASEIWSAVNSEAAAAAKGAWEGVKPAHKVFLSDI
IASPKKNAFVRKWLGTDITYVSFIGAMHVGALLAPFYFTWQAFNCFWVMYFITGCLGITL
SYHRQLSHKSFQTPKWLEYALAYCGALAVQGDPIEWASSHRYHHQHCDTPKDPHTPYEGF
WWSHMGWLLDNEATIERVGDRSNAAEMAAQPFYQFLEKTYMWHIAASALGLYLLGGLPFL
VWGFCVRTVWVYHITWAVNSVAHCWGKQTYNTGDLSRNNLSVGILAFGEGWHNNHHAFEF
SARHGLEWWQVDMTWYLIWGLKKLGLATKVKLPTQKQLDRMRIEPTTA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggattcgtccaacgagaagaagacccttctcacgtcttggcagagaattggc
caggaaggggtgcagaaagcgtctgagatttggtcggcggtgaacagcgaagccgcggcg
gcggcgaaaggcgcgtgggaaggagtgaaaccagcgcataaggtgtttttgtccgatatt
atcgccagtccgaagaagaacgcgtttgtgcgaaagtggttggggacggatataacgtac
gtgtcgtttattggtgccatgcacgttggcgcgttgttggcgccgttttacttcacctgg
caagcgttcaactgcttttgggtcatgtatttcatcaccgggtgcttgggaatcacgttg
agttaccacaggcagttgtcgcacaagtcgtttcaaacgccgaaatggttggagtacgcg
ttggcgtattgcggcgcgttggcggtccaaggcgacccgatcgagtgggcgtcgtcgcac
agatatcatcatcaacactgcgatactccgaaagacccgcacacgccgtatgaaggcttt
tggtggtcgcacatgggatggttgttggacaacgaagcgaccatcgaaagagttggcgat
cgatccaacgccgcggagatggccgcgcagccgttttaccaattcttggagaagacgtac
atgtggcacatcgctgcgtcggcgttaggtttatacctcctcggcggtttacccttctta
gtgtggggcttctgcgtgagaactgtttgggtgtaccacatcacctgggcggtcaactcc
gtcgcccactgctggggcaaacaaacgtacaacaccggcgacttgtccagaaacaactta
tcggttggaattttagcatttggagaagggtggcacaacaaccaccacgcgttcgaattt
agcgccagacacgggttggagtggtggcaagtggacatgacgtggtatttgatttggggg
ttgaagaagttgggcttggcgaccaaggtgaagttgcccacgcaaaagcagttggaccgc
atgcgcatcgaaccgaccacggcttaa

DBGET integrated database retrieval system