KEGG   Bathycoccus prasinos: Bathy06g03330Help
Entry
Bathy06g03330     CDS       T03089                                 

Definition
(RefSeq) hypothetical protein
Organism
bpg  Bathycoccus prasinos
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:619500..620546
Genome map
AA seq 348 aa AA seqDB search
MPEDSSNEKKTLLTSWQRIGQEGVQKASEIWSAVNSEAAAAAKGAWEGVKPAHKVFLSDI
IASPKKNAFVRKWLGTDITYVSFIGAMHVGALLAPFYFTWQAFNCFWVMYFITGCLGITL
SYHRQLSHKSFQTPKWLEYALAYCGALAVQGDPIEWASSHRYHHQHCDTPKDPHTPYEGF
WWSHMGWLLDNEATIERVGDRSNAAEMAAQPFYQFLEKTYMWHIAASALGLYLLGGLPFL
VWGFCVRTVWVYHITWAVNSVAHCWGKQTYNTGDLSRNNLSVGILAFGEGWHNNHHAFEF
SARHGLEWWQVDMTWYLIWGLKKLGLATKVKLPTQKQLDRMRIEPTTA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggattcgtccaacgagaagaagacccttctcacgtcttggcagagaattggc
caggaaggggtgcagaaagcgtctgagatttggtcggcggtgaacagcgaagccgcggcg
gcggcgaaaggcgcgtgggaaggagtgaaaccagcgcataaggtgtttttgtccgatatt
atcgccagtccgaagaagaacgcgtttgtgcgaaagtggttggggacggatataacgtac
gtgtcgtttattggtgccatgcacgttggcgcgttgttggcgccgttttacttcacctgg
caagcgttcaactgcttttgggtcatgtatttcatcaccgggtgcttgggaatcacgttg
agttaccacaggcagttgtcgcacaagtcgtttcaaacgccgaaatggttggagtacgcg
ttggcgtattgcggcgcgttggcggtccaaggcgacccgatcgagtgggcgtcgtcgcac
agatatcatcatcaacactgcgatactccgaaagacccgcacacgccgtatgaaggcttt
tggtggtcgcacatgggatggttgttggacaacgaagcgaccatcgaaagagttggcgat
cgatccaacgccgcggagatggccgcgcagccgttttaccaattcttggagaagacgtac
atgtggcacatcgctgcgtcggcgttaggtttatacctcctcggcggtttacccttctta
gtgtggggcttctgcgtgagaactgtttgggtgtaccacatcacctgggcggtcaactcc
gtcgcccactgctggggcaaacaaacgtacaacaccggcgacttgtccagaaacaactta
tcggttggaattttagcatttggagaagggtggcacaacaaccaccacgcgttcgaattt
agcgccagacacgggttggagtggtggcaagtggacatgacgtggtatttgatttggggg
ttgaagaagttgggcttggcgaccaaggtgaagttgcccacgcaaaagcagttggaccgc
atgcgcatcgaaccgaccacggcttaa

DBGET integrated database retrieval system