KEGG   Bathycoccus prasinos: Bathy09g04500Help
Entry
Bathy09g04500     CDS       T03089                                 

Definition
phosphoenolpyruvate carboxylase
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bpg  Bathycoccus prasinos
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:bpg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bathy09g04500
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bathy09g04500
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bathy09g04500
Enzymes [BR:bpg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Bathy09g04500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:complement(848065..851163)
Genome map
AA seq 1032 aa AA seqDB search
MGLFGGNNKNTDENAPPSGSKPPHGRRLSQSMINTETGKFMSKLINESSYLSGTGETNTF
DTAEAVAESDELMREMFFSIVKETAGEEMLNKIMDVYKISETFSESHSSGDFDKLKNTLD
ALKLDETLMLSSAYSNLLNLHNISEHVATSMEERHARLDDIPRGPAKTTNGAIKGMVASG
MDPNAIYDALCNQHVDLVLTAHPTQALRQSLLKNYGKIRNNLINLQRFRLSRFEREEILE
SIRCCIHSAWRTDEIRRSPPTPQDEMRRGLTYFTNTIFAGVPRFMRRVDTSLLNHGLNRL
PLERSIITFGSWMGGDRDGNPYVTATCTRDSVYLARLQATTLYFKAIEQLIFDLAMWRCS
ASFRKVVDDIVANRPHEEDSVVFEIRRGRNYTDFWKTIPENEPYRVLLGELRDKLYETME
QLQKVVADPSIELDLDDGSDRFIRCKEDLSGPLMHCYESLMECGDEQVANGYLLDVIRQV
QCFGLNLVKLDIRQESDRHADAVDAITTHLGMGSYKEWSEEKKIEFLKSEIEGKRPLIPH
QLECSDEVREVLDTFKMVAHIQKKVPGSLGTYVISMATSASDVLAVVLLQRECGGTLETS
LRVAPLFERLDDLNDAPRVLRQLFSVECYMKTLRNNEQEVMIGYSDSGKDAGRLAAAWGL
YEGQEKAGEVAKEFGVHLTLFHGRGGTVGRGGGPAHIAIMSQPGGTVNGSIRVTIQGEVI
EQDFGERENCFHTLDLYTAAVLEHTLKPPEGPKPEWRVVMKKMSEASCKRYRSVVFENPD
FVPYFAQSTPSTELGSLNIGSRPSKRKPNAGVTALRAIPWIFAWTQSRFQLPVWLGMSAA
FAEIKAQEGELSTLREMHKKWPFFKVTMDLVEMVLAKADLNVVEYYEKTLVDERLRNGLG
KELRNELMTTIDHVLEIADRRELLVNPESKIEVDGQQCPAQHQQLKNKLQMRSIYITPLN
VIQSAYLKKQREIEEMEASNDSSFDELKYDPSLPWAQDMMKLHPSANAFKSAVNDTLIIT
IKGIASGLQNTG
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atgggtttattcggcggcaataacaaaaacaccgacgagaacgcgccgccgagcgggagc
aagcctccgcacggtcggagactctctcaatccatgatcaacacggagactgggaagttc
atgtccaaactcatcaacgaatcgagttatttgtctgggactggggaaacgaatacgttc
gataccgcggaagctgtcgcggaatccgacgagctcatgagagaaatgttcttttccata
gtgaaggaaaccgccggggaggaaatgttgaataaaataatggacgtgtataagatttcg
gaaacatttagcgagtcacactcctcgggggactttgacaagttgaaaaacaccttggac
gcgttgaagttggacgaaacgttgatgttatcctcggcgtattcgaacttgttaaacttg
cacaacatctctgaacacgtagcgacgagtatggaggagagacacgcgcgattggacgat
attccgagaggtccggcaaagacgaccaacggcgcgattaaaggtatggtggccagcggc
atggatccgaacgcgatttacgacgcgttatgtaaccaacacgtcgatttggtgttaacc
gcacacccgacgcaagcgctgagacaatctttgttgaagaactacggcaagatccgtaat
aatttgatcaatttgcaacgttttcgtctctcacgatttgaacgcgaagagattttggag
tccattcggtgctgcattcattcggcatggagaacggacgaaattcgccgttcgccgccg
acgccacaggatgaaatgcgaagaggtttgacgtattttacgaatacaatctttgccggg
gtgccgcggtttatgagacgggtggatacttcgttattgaaccacggtttgaacagactt
cctttggaacgctcgatcattacgtttggctcttggatgggtggcgatcgcgacggaaac
ccgtacgtgacggccacgtgcacgagagattccgtctacctcgccaggttacaagcgacg
acgttatatttcaaagctatcgaacaactcatattcgatcttgccatgtggcggtgctcg
gcatcttttcgaaaagttgtcgacgatatagtcgccaacagaccacacgaagaagactcg
gtcgtgtttgaaatccgcagaggacgtaactacacggacttttggaaaaccattccggaa
aacgaaccgtacagagttctcttgggcgagttaagagacaaattgtacgagacgatggaa
caattacaaaaagttgtcgctgatccgtccatcgagttggatttggacgatggttccgat
cgtttcattcgctgtaaagaagatttatctggcccgttgatgcattgctacgagtctttg
atggaatgcggcgacgaacaagtcgccaatggctatttgctcgacgttattcgtcaagtg
caatgcttcggtctgaatctcgtcaagctcgatatccgacaagaatccgatcgtcacgct
gacgccgtggatgcaatcaccacgcacttgggcatgggttcgtacaaggaatggagcgaa
gagaagaaaattgagtttttgaagagcgaaattgaaggtaaacgtccgttgatcccgcac
cagttggagtgttcggacgaagttcgcgaggttctcgacacgttcaaaatggttgcgcac
attcaaaagaaggttccagggagtttaggaacgtatgtcatttccatggcgacgagtgct
tcggacgttttggcggtggttttgttacaaagagagtgtggcggaactttagaaacgtcg
ctgagagtcgcgcctttgtttgaacgtttggacgatttgaacgatgcgccgagagttttg
agacaactcttctccgtcgagtgctacatgaaaacgttaagaaataacgaacaagaagtt
atgattgggtattcggattctggtaaagatgctggacgtcttgccgcggcgtggggtttg
tatgaaggtcaagagaaagcgggtgaggttgccaaggaatttggcgtgcacttgaccttg
tttcacggcagaggcggtacagttggcagaggcggtggtccggcgcacattgctatcatg
tcgcaaccgggaggaacggtgaatggatctattcgcgttaccattcaaggcgaagttatt
gaacaagatttcggggagagagaaaactgctttcacactttggatttatacaccgccgcg
gttctcgaacacactttgaaaccgccggaaggtccaaaaccagaatggagagtcgtgatg
aaaaaaatgagcgaagcttcgtgcaaaaggtaccgatcggttgtgtttgaaaaccctgat
ttcgttccgtacttcgcgcaaagcacgccgagcacagaattgggaagtttgaacatcggt
tcgcgtccgagtaagcggaaaccgaacgctggcgttacggccttgcgagcgattccttgg
atctttgcctggacgcaaagccgctttcaacttccagtttggttgggtatgtctgccgca
ttcgctgagatcaaagcgcaggaaggcgaactgagcacactgagagaaatgcacaagaag
tggccattttttaaagtgacgatggatttagtcgagatggttttagccaaagctgatttg
aacgtcgtcgagtattatgagaagacgttggtagatgaacgcttgagaaatgggttaggc
aaagagttgaggaacgagttgatgacgaccatcgaccacgttttggaaattgcggaccga
agagagttgttggtgaacccagagtcgaagattgaagtcgacggccaacagtgtccggcg
caacatcagcagttgaagaataagttacaaatgcgttcgatctacatcacgcctttgaat
gtgattcaaagcgcttacttgaagaaacagcgcgaaatcgaagagatggaagccagcaac
gacagttctttcgacgagttgaagtacgatccatcgttgccgtgggcgcaagatatgatg
aagctgcatccgagtgcaaacgcattcaaatcggcggtgaacgatacgctcatcatcact
atcaaaggtatcgcgagtggcttgcaaaacaccggttaa

DBGET integrated database retrieval system