KEGG   Bathycoccus prasinos: Bathy11g02150Help
Entry
Bathy11g02150     CDS       T03089                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
bpg  Bathycoccus prasinos
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bpg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bathy11g02150
Enzymes [BR:bpg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Bathy11g02150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11:387602..389209
Genome map
AA seq 535 aa AA seqDB search
MMCVLFLLSLSVSLATYEAFQLFLKRHVLGIFSVRLSLSNFRFRSANREALYSKSRNAPV
LYVLSLPQTSLMRFFFSRSIYVVLSVWMMQKLEVTASQETKIAFGSCNKHQKMNATSIWT
SIERTNPNAFIWLGDAVYADTRITFEKRKYFGEKFHAEAYAAVKRFPAYERLAKKARILG
TWDDHDYGMNNAGKHWEHKETAKELFLDFLDEGKETERRLERDGVYESYSVYEDDEAKRG
REVQILLLDTRWNFVDGSTPEDGEADILGPKQWEWLEKELMKPSNAEVTLIGSSIQVFAE
LNQMYKAVNYKIAREFGKSIENWGSFPSNQKRLMRLVSKAKERRVIFLSGDVHVGMIDVR
APGCHLPYESIDATSSGITHVAVEEVRPKWVTYFYKKMTPSKFMPRWWYPKNIVPDIYMG
LNFGEVLIHWDKNSLDVNILGESGEVVVSKEVLFSSLEAPKGGTTAEQPTYEECFRERSM
SDFQKQWTFHKAAFFIVFPWIVVLGFGLWAWYVLVVKTICCNPNIGRRKRRSKID
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgcgttctctttcttctttctctctccgtctctctcgcaacgtacgaagcgttt
caactgtttttaaagcggcacgtgttgggaatattctccgtccgtctttcgctctcaaac
tttcgctttcggagcgcaaacagagaggctctttattcgaaatcgcgaaacgcacccgtt
ctttacgttctctctcttcctcaaacttcgctcatgcgctttttcttctcacgcagtata
tacgtcgtcctgtccgtgtggatgatgcaaaaacttgaggtgacggcttctcaagagaca
aaaattgcattcggaagctgcaacaagcaccaaaaaatgaacgcgacttcaatatggacc
tcgatcgaacggactaacccgaacgcattcatatggctcggagacgcggtatacgcggac
actcggattacgttcgagaagaggaagtattttggagagaagttccacgctgaagcgtac
gcggcggtgaagcggttcccggcgtacgagaggctggcgaagaaagcgcggattttaggg
acgtgggacgaccacgattacggcatgaacaacgcggggaaacattgggaacacaaggaa
acggcgaaagagttgtttttagattttttggacgaagggaaggagacggagcgacggttg
gaaagagacggggtgtacgagagttattccgtgtacgaggacgacgaggcgaaacgaggc
agggaggtacagattctattgttggatactcggtggaacttcgtcgacggatcgacgcct
gaagatggagaagcggatattttaggtccaaagcaatgggagtggttggaaaaggagttg
atgaaaccgagcaacgcggaggtgacgttgattgggtcctcgatacaagtgttcgccgag
ctcaatcagatgtataaagcggtgaattataaaatcgcgagagaattcgggaaatcgata
gagaattggggttcgtttccgtcgaatcaaaagaggttaatgcgtctcgtctccaaggca
aaagagagaagggttatattcttatccggcgacgtgcacgtagggatgattgacgttcga
gcgcccggatgtcatttaccgtacgagagcatagacgcgaccagttctggaatcacgcac
gtcgcggtggaagaagtccgaccaaaatgggtgacgtatttttacaaaaagatgacgccg
tcgaagttcatgccgagatggtggtacccgaagaatatcgttcccgatatctacatgggg
ttaaactttggcgaagttttaatacattgggataaaaacagcctagacgtgaacatcttg
ggcgaaagcggtgaagtcgtcgtatccaaggaagtcttattttcctcgctcgaagcgcca
aaaggaggaacgacggcagagcaacccacatacgaggaatgtttccgcgagcgttcgatg
tccgattttcaaaaacaatggacctttcacaaagcggcgtttttcatcgtgttcccgtgg
atcgtagttttgggtttcggcctttgggcgtggtacgtactcgtcgtaaaaacaatctgt
tgcaacccgaatataggtcgacgaaaacgacgttcgaaaatagattaa

DBGET integrated database retrieval system