KEGG   Paraburkholderia phymatum: Bphy_0198Help
Entry
Bphy_0198         CDS       T00704                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00071  Fatty acid degradation
bph00280  Valine, leucine and isoleucine degradation
bph00281  Geraniol degradation
bph00310  Lysine degradation
bph00360  Phenylalanine metabolism
bph00362  Benzoate degradation
bph00380  Tryptophan metabolism
bph00410  beta-Alanine metabolism
bph00627  Aminobenzoate degradation
bph00640  Propanoate metabolism
bph00650  Butanoate metabolism
bph00903  Limonene and pinene degradation
bph00930  Caprolactam degradation
bph01100  Metabolic pathways
bph01110  Biosynthesis of secondary metabolites
bph01120  Microbial metabolism in diverse environments
bph01130  Biosynthesis of antibiotics
bph01212  Fatty acid metabolism
Module
bph_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bphy_0198
   00650 Butanoate metabolism
    Bphy_0198
  Lipid metabolism
   00071 Fatty acid degradation
    Bphy_0198
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bphy_0198
   00310 Lysine degradation
    Bphy_0198
   00360 Phenylalanine metabolism
    Bphy_0198
   00380 Tryptophan metabolism
    Bphy_0198
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bphy_0198
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bphy_0198
   00281 Geraniol degradation
    Bphy_0198
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bphy_0198
   00627 Aminobenzoate degradation
    Bphy_0198
   00930 Caprolactam degradation
    Bphy_0198
Enzymes [BR:bph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bphy_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACC69391
JGI: Bphy0198
UniProt: B2JKK2
Position
1:222377..223237
Genome map
AA seq 286 aa AA seqDB search
MSAMSHESESHTVEPAFYAHYRSLRVRRHAHGILEIVMSGEGANKSNLATADANMHRELA
DIWRDVDRDPDTRVAVIRGEGKGFSAGGDLGLVEDMANDFDVRTRVWREARDLVYNVINC
SKPIVSAMHGPAVGAGLVAGLLADISIATKSARIIDGHTRLGVAAGDHAAIVWPLLCGMA
KAKYYLMLCEPVSGEEAERIGLVSLAVDDNDLLPKTFEVARKLASGSQTAIRWTKYALNN
WLRSAGPAFDTSLALEFMGFAGPDVREGVASLRERRAPDFPGKEPF
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccatgtctcacgaatcggaatcccacacggtcgaacccgcgttctacgcgcac
tacaggtcgctgcgcgtgcggcgtcacgcgcacggcatcctcgaaatcgtgatgagcggc
gagggcgccaacaaaagcaatctcgctaccgccgatgcgaacatgcatcgtgagctggcc
gacatctggcgcgatgtcgaccgcgatcccgacacgcgggtcgcggtgattcgcggcgaa
ggcaagggcttttcggcggggggcgatctcgggctcgtcgaagacatggcgaacgacttc
gacgtgcgcacgcgcgtgtggcgcgaggcgcgcgatctcgtctacaacgtgatcaactgc
agcaagccgatcgtctcggcgatgcacgggccggccgtcggcgcggggctcgtcgcggga
ctgctcgcggatatctcgattgcgacgaaatcggcgcgcatcatcgatggtcatacgcgg
ctgggcgtcgcggcgggcgaccatgcggcgatcgtttggccgctcctgtgcggcatggcg
aaggcgaagtactacctgatgctgtgcgaacccgtgagcggcgaagaagcggagcgcatc
ggtctcgtgtcgctagccgtcgacgacaacgatctgctgccgaaaaccttcgaagtcgcg
cgcaagctcgcgagcggttcgcagacggcgatccgctggaccaagtacgcgctgaacaat
tggctgcgctcggcgggccccgctttcgacacgtcgctcgcgctcgaattcatgggtttc
gcgggaccggacgtgcgcgagggcgtggcgtcgctgcgcgagcggcgcgcgccggatttt
ccgggcaaagagccgttctga

DBGET integrated database retrieval system