KEGG   Paraburkholderia phymatum: Bphy_0266Help
Entry
Bphy_0266         CDS       T00704                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00010  Glycolysis / Gluconeogenesis
bph00260  Glycine, serine and threonine metabolism
bph00680  Methane metabolism
bph01100  Metabolic pathways
bph01110  Biosynthesis of secondary metabolites
bph01120  Microbial metabolism in diverse environments
bph01130  Biosynthesis of antibiotics
bph01200  Carbon metabolism
bph01230  Biosynthesis of amino acids
Module
bph_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bph_M00002  Glycolysis, core module involving three-carbon compounds
bph_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bphy_0266
  Energy metabolism
   00680 Methane metabolism
    Bphy_0266
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bphy_0266
Enzymes [BR:bph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bphy_0266
Membrane trafficking [BR:bph04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Bphy_0266
Exosome [BR:bph04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bphy_0266
  Exosomal proteins of melanoma cells
   Bphy_0266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACC69459
JGI: Bphy0266
UniProt: B2JC95
Position
1:complement(310518..311264)
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNLEAQQAGTLLKDSGYMFDIAYTSVLKR
AIRTLWHVQDKMDLMYLPVVHSWRLNERHYGALSGLNKAETAARFGDEQVLVWRRSYDTP
PPALEPTDSRTSYDDPRYAKVPREELPLTECLKDTVARVMPIWNESIAPAIKSGRKVLIA
AHGNSIRALVKYLDNISDSDIVGLNIPNGVPLVYELDENLKPIKHYYLGDQEAIAKAQAA
VAKQGKAG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgttctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttt
accggctgggtcgacgtcgatctcaccgaacagggcaacctcgaagcgcagcaggcaggc
acgctgctcaaggattcgggctacatgttcgacatcgcgtacacctcggtgcttaaacgc
gcgatccgcacactgtggcacgtgcaggacaagatggatctgatgtatctgcccgtggtg
cactcgtggcgtctcaacgagcgccactacggcgcgctgtctgggctgaacaaggccgaa
accgccgccaggttcggcgacgagcaggtgctggtctggcgccgcagctacgacacaccg
ccgcccgcgctcgagccgaccgactcccgcacatcgtacgacgacccgcgctatgcgaag
gtgccgcgcgaagaactgccgttgacggaatgcctgaaagacaccgtcgcgcgcgtgatg
ccaatctggaacgaatcgatcgctcccgcgatcaagtcgggccgcaaggtgctgatcgcc
gcgcacggcaactcgatccgcgcgctggtcaagtatctggacaacatttccgacagcgac
atcgtcggcctgaacatcccgaatggcgtgccgctcgtgtatgaactggacgagaacctg
aaaccgatcaagcactactatctcggtgatcaggaagcgatcgcgaaggcgcaggctgct
gtcgccaagcaaggcaaggcaggctga

DBGET integrated database retrieval system