KEGG   Burkholderia phymatum: Bphy_0419Help
Entry
Bphy_0419         CDS       T00704                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bph  Burkholderia phymatum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bph00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(477898..479397)
Genome map
AA seq 499 aa AA seqDB search
MQDQYILALDQGTTSSRAMLFDRNGNVVSVAQKEFRQIYPHPGWVEHDPLEIWATQAGVA
AEAVTHAGLNGTSIAAIGITNQRETTIVWDRQTGHPIYNAIVWQDRRTADFCDQLKAQGL
EDEVRAKTGLPVDSYFSATKIRWILDNVEGAREKAKQGKLAFGTVDSWLVWNFTKHELHI
TDVTNASRTMLFNIHTLQWDDALLDALDIPRSMLPEVRPSSEVYGPTKTTVFASKIPLAG
IAGDQHAALFGQMCTRSGMVKNTYGTGCFLVMNTGTKPIESKNNLVTTIAWQIGDQINYA
LEGSIFIAGAVVQWLRDGLGIIRSASEVETLARGVEHCDGVYLVPAFAGLGAPHWNARAR
GTLFGVTRGTTSAHIARAALDSIAYQSMDVLKAMEADSGIHINELRVDGGACANNLLMQF
QADILGVDAVRPQVSETTALGAAYLAGLATGYWKDIEELQNQWKLEHRFSPSLPADQAKA
CLDGWQRAIRAAKAWADAP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatcagtacatcctggcactagaccagggcaccacgagttcgcgcgcgatgctg
ttcgatcgcaacggcaacgtcgtctcggttgcgcaaaaagaattcaggcagatctatccg
catccgggctgggtcgaacacgatccgctggaaatctgggcgacgcaggcgggcgtcgca
gccgaagccgtcacgcacgcagggctgaacggcacgtcgatcgcagcgatcggcatcacg
aaccagcgcgagacgacgatcgtctgggaccgccagacaggtcatcccatctacaacgcg
atcgtctggcaggaccgccgcacggccgacttctgcgaccagctgaaggcgcaaggcctc
gaagacgaggtccgtgcaaagacgggcttgccggtcgactcatacttctcggcaacgaag
atccgctggatcctcgacaacgtcgaaggcgcgcgcgaaaaagcgaagcaaggcaagctc
gcgttcggcacggtggacagctggctcgtgtggaatttcaccaagcacgaactgcatatc
accgacgtgaccaacgcgtcgcgcacgatgctcttcaacattcacacgctgcaatgggac
gacgcgttgctcgacgcgctcgacattccgcgcagcatgctgcccgaagtgcgcccttcg
tcggaagtgtatgggccgacgaagacgactgtgttcgcatcgaagattccgctcgcgggc
atcgcgggtgatcagcatgcggcgctgttcggccagatgtgcacgcgttccggcatggtg
aagaacacctacggcaccggctgctttctcgtgatgaacacgggcacgaagccgatcgaa
tcgaagaacaatctggtcacgacgatcgcatggcagatcggcgatcagatcaattacgcg
cttgaaggcagtatcttcatcgcgggcgccgtcgtgcagtggctgcgcgacggactgggc
atcatccgcagcgcgtcggaagtcgagacgctcgcgcgcggcgtcgaacattgcgacggc
gtgtatctcgtgccggcattcgcgggactcggcgcgccacactggaacgcgcgtgctcgc
ggcacgctgttcggcgtcacgcgcggcacgacgtcagcgcacatcgcgcgcgcggcgctg
gattcgatcgcttatcaatcgatggatgttctgaaggcgatggaagccgactcgggcatc
catatcaacgaattgcgcgtggatggcggcgcgtgcgcgaacaatctgctgatgcagttc
caggccgacattctcggcgtcgacgccgtgcgcccgcaggtcagcgaaacgaccgcgctt
ggcgctgcgtatctggcgggactcgcaaccggctactggaaagacatcgaggaactgcag
aaccaatggaagctcgaacatcgcttctcgccgtcgctgcccgccgaccaggcgaaggcc
tgcctcgacggctggcagcgcgcgatccgcgccgcgaaagcgtgggccgacgcaccttga

DBGET integrated database retrieval system