KEGG   Paraburkholderia phymatum: Bphy_0625Help
Entry
Bphy_0625         CDS       T00704                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00010  Glycolysis / Gluconeogenesis
bph00052  Galactose metabolism
bph00500  Starch and sucrose metabolism
bph00520  Amino sugar and nucleotide sugar metabolism
bph00521  Streptomycin biosynthesis
bph01100  Metabolic pathways
bph01110  Biosynthesis of secondary metabolites
bph01120  Microbial metabolism in diverse environments
bph01130  Biosynthesis of antibiotics
bph01200  Carbon metabolism
Module
bph_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bphy_0625
   00052 Galactose metabolism
    Bphy_0625
   00500 Starch and sucrose metabolism
    Bphy_0625
   00520 Amino sugar and nucleotide sugar metabolism
    Bphy_0625
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bphy_0625
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Bphy_0625
Enzymes [BR:bph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bphy_0625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase HTH_6 SIS SIS_2 ROK LacI
Motif
Other DBs
NCBI-ProteinID: ACC69815
JGI: Bphy0625
UniProt: B2JED8
Position
1:complement(701847..703766)
Genome map
AA seq 639 aa AA seqDB search
MSTGVQTKAAPGAGQHADGPRLLADIGGTNARFALETGPGEITQVLVYPCADYPGVADVI
KKYLKDTKIGRVNHAAIAIANPVDGDQVSMTNHDWTFSIEATRRALGFDTLLVVNDFTAL
AMALPGLTDSQRVQVGGGSRRQNSVIGLLGPGTGMGVSGLIPADDRWIALGSEGGHATFA
PMDEREDLVLQYARKKWSHVSFERVAAGPGIEVIYRALAGRDKKRVPATIEVSEIVKKGL
DGDPLAAETIDVFCGILGTFAGNIAVTLGALGGIYIGGGVVPRLGEVFARSSFRQRFEAK
GRFEAYLKNVPTYVITAEYPAFLGVSAILAEQLSNRAGGSSSAVFERIRQMRDALTPAER
RVADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIP
VSHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVESAIDLLNGARRIEFYGLGNS
NIVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLEVAM
QAGAKVIAITSSNTPLAKRATVALETDHIEIRESQLSMISRILHLLMIDILAVGVAIRRA
APASSEVSAAVAKARKGADDDTSAVLDWLSHGAAASPKD
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgtgcaaactaaagctgcccccggcgcgggccagcacgccgacggaccg
aggctgctcgccgacatcggcggcaccaatgcgcgcttcgcgcttgagacgggtccaggc
gaaattacgcaggttctcgtctatccctgcgcggactatcctggtgtcgcagatgtcatc
aagaagtatctgaaagacacgaagatcggtcgcgtgaatcatgctgcgattgcgatcgcg
aatcccgtcgatggcgatcaggtcagcatgaccaaccacgactggacgttctcgatcgaa
gcgacacgccgcgcactcggcttcgacacgctgctggtggtcaacgacttcactgcgctc
gcgatggcgctgccgggtctcaccgattcgcaacgcgtgcaggtgggcggcggctcgcgc
cggcagaacagcgtgattggcctgctcgggccgggcacgggcatgggcgtgtcgggtctg
attcccgccgacgaccgctggatcgcgctcggcagcgaaggcggccacgccacctttgcg
ccgatggacgaacgcgaagacctggtgttgcagtatgcgcgcaagaagtggtcgcacgtg
tcgttcgaacgtgtcgcggccggccccggcatcgaagtgatctatcgcgcgctcgcgggg
cgcgacaagaagcgcgtgcccgcgacgatcgaagtgtcggagatcgtcaagaaggggctc
gacggcgatccgctcgcggctgaaacgatcgatgtgttctgcggcattcttggcacgttc
gcggggaatatcgcggtgacgctcggcgcgctgggcggcatttatatcggcggcggcgtc
gtgccgcgcctgggtgaagtgttcgcacgctcatcgttccgtcaacgcttcgaggcgaaa
ggccgcttcgaagcgtatctgaagaacgtgccgacgtacgtgatcaccgcggagtatccg
gccttcctgggcgtgtcggcgattctcgctgagcagttgtcgaatcgggcgggcggcagt
tcgtcggcggtattcgaacggattcgccagatgcgcgatgcgctgacgccggccgagcgg
cgtgttgcggatctcgcgttgaaccatccgcgctcgatcatcaacgatccgatcgtcgat
atcgcgcgcaaggccgacgtaagtcagccgacggtgatccgcttctgccgttcactgggc
tgccagggtctttccgatttcaaactgaagctggcgacgggtttgacgggcacgatccct
gtctcgcatagccaggtgcatctcggcgataccgcaacggatttcggcgcgaaggtgctg
gacaataccgtgtccgcgatcttgcagttgcgcgagcacctgaatttcgagcatgtcgag
tcggcgattgatctgctgaacggcgcgcgacgtatcgagttctatggtttgggcaactcg
aacatcgtcgcgcaggatgcgcattacaagttcttccgcttcggcattccgaccattgct
tatggcgatctgtatatgcaggcggcgtcggcggcgctgctcggcaaaggtgacgtgatc
gttgccgtttcgaagtcgggacgcgcgccggaattgctgcgcgtgctggaagtagcgatg
caggcgggtgcgaaggtgattgccatcacgtcgagcaatacgccgctggcgaaacgcgcg
acggtcgcactcgagacggatcacatcgagattcgcgaatcgcagctgtcgatgatctcg
cggatcttgcatctgctgatgatcgatattctggctgtcggggtggcgattcggcgcgct
gcgccggcttcatcggaagttagcgctgccgttgccaaggcccgtaaaggcgccgatgat
gatacatcggcggtgctcgactggcttagtcatggggcggccgcctcgccgaaggattaa

DBGET integrated database retrieval system