KEGG   Paraburkholderia phymatum: Bphy_0638Help
Entry
Bphy_0638         CDS       T00704                                 

Definition
(GenBank) agmatinase
  KO
K12255  guanidinobutyrase [EC:3.5.3.7]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00330  Arginine and proline metabolism
bph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bphy_0638
Enzymes [BR:bph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     Bphy_0638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase 2-Hacid_dh B12-binding_2
Motif
Other DBs
NCBI-ProteinID: ACC69828
JGI: Bphy0638
UniProt: B2JEF1
Position
1:718397..719389
Genome map
AA seq 330 aa AA seqDB search
MNTSSNFVSPDLTERPQPLSGNAMPRSGGIATMMRLPNVGSAQGLDVCFVGVPFDLGTSN
RTGARFGPRQIRAESVLLRPYNMATRAAPFDSLRVADIGDVAINPYNLLDSICRIERAYD
EILEHGTKPITLGGDHTITLPILRAIHRKYGKVGLIHVDAHADVNDMMMGEKIAHGTPFR
RAVEEGLLDCDRVVQIGLRGTGYAAEDFDWCRDQGFQVVQAEACWNQSLVPLMSRVREQM
GDGPVYFTFDIDGIDPAFAPGTGTPEIAGLTVPQALEIIRGAHGLNIVGCDLVEVAPPYD
PFGTTALLGANLAFELLCVLPGVEYRPSTR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttcctcgaatttcgtttcccccgacctgaccgaacggccgcagccgctgtca
ggcaacgcgatgccgcgctctggcggaatcgccacgatgatgcggctgccgaacgtcggc
tcagcgcaagggctcgatgtgtgtttcgtcggcgtgccgttcgatctgggcacgtcgaac
cgcacaggcgcgcgcttcggcccgcgtcagattcgggccgaatcggtgctgctgcgtcca
tacaatatggcaacgcgcgcggcgccgttcgattcgctgcgtgtcgcggatatcggcgat
gtcgccatcaatccgtacaacctgctggattcgatctgccgcattgagcgcgcttacgat
gaaatcctggaacatggcacgaagccgatcacgctgggcggcgaccatacgatcacgctg
ccgattctgcgcgcgatccaccgcaaatatggcaaggtcggcctgattcacgtcgacgcc
cacgcggacgtcaacgacatgatgatgggagaaaagatcgcgcacggcacgccgttccgc
cgggcggtcgaagagggtttgctcgattgcgaccgcgtagtgcagatcggcttgcgtggt
acgggctacgcggcggaagacttcgactggtgccgcgatcagggctttcaggtcgtgcag
gcagaagcgtgctggaatcagtcgctggtgccgctgatgtcgcgtgtgcgcgagcagatg
ggcgacggccccgtctactttacgttcgatatcgacgggatcgatccggccttcgcgccg
ggtacgggcacgcccgagatcgccgggctgacggtgccgcaggcgctcgaaatcatccgt
ggcgcgcacgggctgaatatcgtcggctgcgatctggtggaggtcgcgccgccatacgat
ccgttcggcacgacggcgctgctcggcgcgaaccttgcctttgaactgttgtgcgtgctg
ccgggcgtcgagtatcggccgtcgacgcgatag

DBGET integrated database retrieval system