KEGG   Burkholderia phymatum: Bphy_0638Help
Entry
Bphy_0638         CDS       T00704                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bph  Burkholderia phymatum
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bph00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:718397..719389
Genome map
AA seq 330 aa AA seqDB search
MNTSSNFVSPDLTERPQPLSGNAMPRSGGIATMMRLPNVGSAQGLDVCFVGVPFDLGTSN
RTGARFGPRQIRAESVLLRPYNMATRAAPFDSLRVADIGDVAINPYNLLDSICRIERAYD
EILEHGTKPITLGGDHTITLPILRAIHRKYGKVGLIHVDAHADVNDMMMGEKIAHGTPFR
RAVEEGLLDCDRVVQIGLRGTGYAAEDFDWCRDQGFQVVQAEACWNQSLVPLMSRVREQM
GDGPVYFTFDIDGIDPAFAPGTGTPEIAGLTVPQALEIIRGAHGLNIVGCDLVEVAPPYD
PFGTTALLGANLAFELLCVLPGVEYRPSTR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttcctcgaatttcgtttcccccgacctgaccgaacggccgcagccgctgtca
ggcaacgcgatgccgcgctctggcggaatcgccacgatgatgcggctgccgaacgtcggc
tcagcgcaagggctcgatgtgtgtttcgtcggcgtgccgttcgatctgggcacgtcgaac
cgcacaggcgcgcgcttcggcccgcgtcagattcgggccgaatcggtgctgctgcgtcca
tacaatatggcaacgcgcgcggcgccgttcgattcgctgcgtgtcgcggatatcggcgat
gtcgccatcaatccgtacaacctgctggattcgatctgccgcattgagcgcgcttacgat
gaaatcctggaacatggcacgaagccgatcacgctgggcggcgaccatacgatcacgctg
ccgattctgcgcgcgatccaccgcaaatatggcaaggtcggcctgattcacgtcgacgcc
cacgcggacgtcaacgacatgatgatgggagaaaagatcgcgcacggcacgccgttccgc
cgggcggtcgaagagggtttgctcgattgcgaccgcgtagtgcagatcggcttgcgtggt
acgggctacgcggcggaagacttcgactggtgccgcgatcagggctttcaggtcgtgcag
gcagaagcgtgctggaatcagtcgctggtgccgctgatgtcgcgtgtgcgcgagcagatg
ggcgacggccccgtctactttacgttcgatatcgacgggatcgatccggccttcgcgccg
ggtacgggcacgcccgagatcgccgggctgacggtgccgcaggcgctcgaaatcatccgt
ggcgcgcacgggctgaatatcgtcggctgcgatctggtggaggtcgcgccgccatacgat
ccgttcggcacgacggcgctgctcggcgcgaaccttgcctttgaactgttgtgcgtgctg
ccgggcgtcgagtatcggccgtcgacgcgatag

DBGET integrated database retrieval system