KEGG   Burkholderia phymatum: Bphy_0642Help
Entry
Bphy_0642         CDS       T00704                                 

Definition
seryl-tRNA synthetase (EC:6.1.1.11)
Orthology
K01875  
seryl-tRNA synthetase [EC:6.1.1.11]
Organism
bph  Burkholderia phymatum
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bph00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:724326..725624
Genome map
AA seq 432 aa AA seqDB search
MLDIQLLRKDIDGVAKRLADRGYILDVAAFSALEAERRAIQTRTEELQAKRNSLSKQIGA
MKGRGEDTSAVMAEVGGIGDEMKASAVQLEDIQKRLSDLLLGVPNLAHESVPVGNDEAGN
VEVRRWGTPRQFDFEIKDHVDVGTPLGLDFETGAKLSGARFTLLRGQIARLHRALAQFMI
DTHTQQHGYTEVYTPYIVNPEILFGTGQLPKFADDMFRVEKGGGENTVTQYLISTSEISL
TNTVRDSIVDSNELPIKLTAHSPCFRSEAGSYGRDTRGMIRQHQFDKVEMVQIVSPDTSY
DALEQMVAHAEVILQKLELPYRVITLCTGDMGFSAAKTYDLEVWVPAQNTYREISSCSNT
EAFQARRMQARFRNAQGKPELVHTLNGSGLAVGRTLVAVLENFQNADGSVTVPAALRPYL
GGVDRLEVKASA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacatccagttgctgcgcaaagacatcgacggcgtcgcgaagcgcctcgccgat
cgcggctatatcctcgacgtcgcggctttctccgcgctcgaagccgaacgccgcgccatc
cagacccgtaccgaagagctgcaggcaaagcgcaacagcctgtcgaagcagatcggtgcg
atgaaagggcggggcgaagacacgtccgcggtgatggccgaggtgggcggtatcggcgac
gagatgaaggcgtcggcagtgcaactcgaagacatccagaagcgcctgtcggatctgctg
ctcggcgtgccgaaccttgcgcacgaaagcgtgcccgtcggcaacgacgaggccggcaac
gtcgaagtccgccgctggggaacgccgcgccagttcgacttcgagatcaaggatcacgtc
gacgtcggcacgccgctcgggctcgatttcgaaacgggcgcgaagctgtcgggcgcgcgc
ttcacgctgctgcgtggacagattgcgcgtctgcaccgcgcgcttgcgcagttcatgatc
gacacgcacacgcagcagcacggctacacggaagtctatacaccgtatatcgtcaatccc
gaaatcctgttcggcacgggccaactgcccaagttcgccgacgacatgttccgcgtcgaa
aagggcggcggcgaaaacacggtgacgcaatacctgatctcgacgtcggagatttcgctg
actaacacggtgcgcgacagcatcgtcgactcgaacgaattgcccatcaagctgacggct
cattcgccgtgctttcgctcggaagcgggctcgtacggtcgcgacacccgcggcatgatc
cgtcagcatcagttcgacaaggtcgagatggtgcagatcgtgtcgcccgacacgtcatac
gacgcgctcgagcagatggtcgcgcacgcggaagtgatcttgcagaagctcgaactgccg
tatcgtgtcatcacgctgtgcaccggcgatatgggcttttcggcagcgaaaacgtatgac
ctagaagtgtgggtgcctgcgcagaatacctatcgcgagatctcgagctgttcgaacacg
gaagcgttccaggcgcgccggatgcaagcgcgcttccgcaacgcgcagggcaagcccgaa
ctcgttcatacgctgaacggttcgggcctcgctgtcggccgtacacttgtcgccgtgctg
gagaatttccagaacgccgatggctcggtgacggttccggccgcgctgcgcccgtatctc
ggtggcgtcgatcgacttgaagtgaaggcgtctgcctga

DBGET integrated database retrieval system