KEGG   Burkholderia phymatum: Bphy_0846Help
Entry
Bphy_0846         CDS       T00704                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bph  Burkholderia phymatum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bphy_0846
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Bphy_0846
Enzymes [BR:bph01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bphy_0846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:944619..945650
Genome map
AA seq 343 aa AA seqDB search
MKLTPGPVMLDVVGKALNADDERRLAHPMTGGVILFARHFESRSQLVALTDAIRATRDDL
LIAVDHEGGRVQRFRTDGFTVLPSMGKLGALWDEDVLRATKVTTAVGYVLASELRACGID
MSFTPVLDLNYGHSQVIGDRAFHRDPRVVTMLAKSLNHGLALAGMANCGKHFPGHGFATA
DSHVAVPVDERTLDQILSEDVAPYDWLGLSLASVLPGHVIYPKIDSKPAGFSRVWIQDIL
RNKLGFEGAIFSDDLSMEAARQGGTLTEAATAALEAGVDMVLICNQPDEAGKVLDALRVT
QSNESKQRLARMRPRGDAPSWAALMDEPQYRRAQALLRETFAA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgactcctggcccggtgatgctcgacgtcgtcggcaaagccctgaacgccgat
gacgagcgccgcctcgcgcacccaatgacgggcggcgtgatcctgtttgcacgtcacttc
gaaagccgctcgcaactggtcgcgctgaccgacgcgattcgcgcgactcgcgacgacctt
ctgatcgccgtcgatcacgaaggcggccgtgtgcagcgctttcgcaccgatggcttcacc
gtgctgccgtcgatgggcaagctcggcgcgctgtgggacgaggatgtgctgcgcgcgacc
aaagtcacgacggcagtcggctatgtgctcgcatccgagttgcgcgcgtgcggcatcgac
atgagcttcacgcccgtgctcgatttgaactacggtcactcgcaggtgatcggcgatcgc
gcgttccatcgcgatccgcgcgtcgtgacgatgctggcgaagagcctgaatcacggcctc
gcgctcgcgggcatggcgaactgcgggaagcattttcccggtcacgggttcgcgacggcg
gactcgcatgtggctgtgcccgtcgacgaacgtacgctcgaccagattctcagcgaagac
gtcgcgccgtatgactggctcggactctcgctcgcgtcggtgctgccggggcatgtgatc
tatccgaagatcgacagcaagccggccggtttttcgcgtgtgtggatccaggacatcctg
cgcaacaagctgggattcgagggcgcgattttcagcgacgatctgtcgatggaagcggcg
cgccagggcggcacgctgacggaagcggccacggccgcgctcgaagcgggtgtcgacatg
gtgctgatctgcaatcagcccgacgaggcaggaaaggtactggacgcgctgcgcgtcacg
caatcgaacgagtcgaagcagcgccttgcgcgcatgcgtccgcgcggcgacgcgccgtca
tgggccgcattgatggacgagccgcagtatcgacgggcacaggcgctgctgcgcgagact
ttcgctgcgtga

DBGET integrated database retrieval system