KEGG   Burkholderia phymatum: Bphy_0953Help
Entry
Bphy_0953         CDS       T00704                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bph  Burkholderia phymatum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bph00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bphy_0953 (recR)
DNA repair and recombination proteins [BR:bph03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Bphy_0953 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1065380..1065976
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSALVEALRALPGVGPKSAQRMAYHLMQHDREGAEKLGRSLLFATEHLQHCEKC
NTFTEAQICEVCSDTERDPTLLCVVETPADQIMLEQTMTWRGLYFVLMGRLSPLDGIGPK
EIHFDRLVKRATDGVVKEVVLATNFTNEGEATAHYLGQTLKSRGLSVTRLARGVPVGGEL
EYVDAGTIARAMLDRRSI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaccttccgccttgtcggcgctcgtcgaagcgctgcgcgcattgcctggcgtc
ggcccgaagtccgcgcagcgcatggcctatcacctgatgcagcacgaccgggaaggcgcg
gaaaagctcggccgctcgctgctgttcgcgaccgagcatctgcagcactgcgagaagtgc
aacacgttcacggaagcgcagatctgcgaagtctgcagcgacaccgagcgcgatccgacc
ttgctgtgcgtcgtcgaaacgcccgccgaccagatcatgctcgaacagacgatgacatgg
cgcggcctgtatttcgtgctgatggggcggctgagtccgctcgacggcatcggtccgaag
gaaatccatttcgaccggcttgtgaagcgcgcgacggacggcgtcgtgaaggaagtcgtg
ctcgcgaccaacttcacgaacgaaggcgaagccacggcgcattatctcggccagacgctg
aagtcgcgtggcttgtccgtcacacggctcgcgcgcggcgtgcccgtcggcggcgagctc
gaatatgtcgacgcgggcacgattgcgcgcgcgatgctcgaccggcgctcgatctag

DBGET integrated database retrieval system