KEGG   Burkholderia phymatum: Bphy_1017Help
Entry
Bphy_1017         CDS       T00704                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bph  Burkholderia phymatum
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bph01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1141937..1142581)
Genome map
AA seq 214 aa AA seqDB search
MPAHATGDTSAGAAAATRSAAGSNAQSSKPTIVVLGDSLSAEYGLPRDTGWVSLMRQRLS
NAQIDYNVANASISGDTTSGGRARLPALMQRLKPAIVIVELGANDALRGVPLSTTEDNLR
TIVEQAQQGHAKVLLVGMYVPPNYGPDYTQKFHALYGQLSKQLRVPLVPFLLAGIEDKPD
MFQSDQIHPTQRAQPLLLDNVWPALKPLLHTSPQ
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctcatgcaacgggcgacacgagcgcgggtgcggcggcagcaacccgaagcgcg
gcaggcagtaacgcacaatcgtcgaagccgaccatcgtcgtacttggcgacagcctctcc
gccgaatacggcttgccccgggacacgggctgggtttccttgatgcgccagcgactgtcg
aatgcgcagatcgattataacgttgcgaatgcgagcatcagcggcgacaccacgagcggc
gggcgcgcccgcttgcccgcgctgatgcaacggctcaagccggccatcgtaatcgtcgag
ctcggcgccaacgacgcgctgcgcggtgtcccgctgagcacgacggaagacaacctgcgc
acgatcgtcgaacaggcccagcaaggacacgcgaaggttctgctcgtcgggatgtacgtg
ccgcccaactacgggcccgactacacgcagaagttccacgccctctatggacaactgtcg
aagcagttgcgcgtgccgctcgtcccattcctcctcgccggaatcgaagacaagccagac
atgttccagtctgatcagattcatccgacgcaacgggcacagcccctgctactggacaac
gtgtggccggcgctgaagccgctgctccacacctcgccccaatga

DBGET integrated database retrieval system