KEGG   Burkholderia phymatum: Bphy_1077Help
Entry
Bphy_1077         CDS       T00704                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bph  Burkholderia phymatum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bphy_1077
   00052 Galactose metabolism
    Bphy_1077
   00500 Starch and sucrose metabolism
    Bphy_1077
   00520 Amino sugar and nucleotide sugar metabolism
    Bphy_1077
Enzymes [BR:bph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bphy_1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1213480..1214382
Genome map
AA seq 300 aa AA seqDB search
MHTMLKVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIAAGITEMIFVT
GRSKRAIEDHFDKSYEIEAELEARGKEQLLDLVRSIKPSNVDCFYVRQAEALGLGHAVLC
AEKLVGGSPFAVILADDLLHSEKPVMKQLVDTFNHYHSSVVGVETIAREASRSYGVVDGK
EWEEDVIKLSGIVEKPAPDKAPSNLGVVGRYVLMPTIFKHIRALKPGAGGELQLTDALQS
LLTEEQVLAYRYFGTRFDCGSKLGYLKATVEFALRHPEVRADFEDFLQSYLPLHLTAAAA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcataccatgctgaaagtcaccaaagccgtctttcctgttgcgggtctcggcacacgt
tttctgcctgccacgaaggcgagcccgaaggaaatgctgcccatcgtcgacaagccgctg
atccagtacgcagtcgaagaagcaatcgcagcgggcatcaccgaaatgatcttcgtcacg
ggccgcagcaagcgggccatcgaagatcacttcgacaagtcctatgagatcgaagccgaa
ctcgaagcacgcggcaaggaacagttgctggatctcgtgcgcagcatcaagccgtcgaac
gtcgactgcttctatgtgcgccaggcggaagcgctgggtctcggtcatgccgtgctgtgc
gcggaaaaactggtcggcggcagcccgttcgccgtgattctcgcggacgacctgctgcac
agcgaaaagcccgtgatgaagcagctcgtcgacacgttcaatcactatcacagctcggtg
gtcggcgtcgaaacgatcgcgcgcgaagcgagccgttcgtacggcgtcgtcgacggcaag
gagtgggaagaggacgtgatcaagctgtccggcatcgtcgaaaagccggcgcccgacaag
gccccgtcgaatctcggcgtggttggccgctacgtgctgatgccgaccatcttcaagcac
atccgcgcgctgaagccgggcgcaggcggcgaactgcaactgacggatgcgctgcaatcg
ctgctgacggaagagcaggtgctcgcctatcgctacttcggtacgcgtttcgattgcggc
agcaagctgggctacctgaaagcgacggtggaattcgcgctgcgtcatcccgaagtgcgc
gcggatttcgaagacttcctgcaaagctatctgccgctgcatctgacggcagcggctgcc
tga

DBGET integrated database retrieval system