KEGG   Burkholderia phymatum: Bphy_1098Help
Entry
Bphy_1098         CDS       T00704                                 

Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bph  Burkholderia phymatum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bphy_1098
   01230 Biosynthesis of amino acids
    Bphy_1098
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bphy_1098
   00030 Pentose phosphate pathway
    Bphy_1098
   00051 Fructose and mannose metabolism
    Bphy_1098
   00052 Galactose metabolism
    Bphy_1098
  Energy metabolism
   00680 Methane metabolism
    Bphy_1098
Enzymes [BR:bph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Bphy_1098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1240373..1241377)
Genome map
AA seq 334 aa AA seqDB search
MIDVLTVTLNPAVDLSTSVERIVDTHKLRCETAQRDPGGGGVNVARVLHRLGSECVALFA
AGGVTGRMLGGMLDGEKLRTRCIDIKGETRENFSVMETSTRREYRFVLPGPTLAPAEWTE
CLRSVQAHVDSARFLVLSGSLPPGAPADAYAQLARAAATARPNIRVAVDASGPTLAAALA
GGLVDIVKPSLNELRELTALPLNDVGDQIDAARMLIVQRKARMVALTLAEQGAMLVTHDE
AWFMPALKTEVLSAIGAGDSFLAGLIWSLDHGAVASEALAYAAAAAAAAMKQTGTRLCDA
RDVTQAYAKGERAVRVQDPARFRIVHRESAPSRQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgttctcacagtcaccctgaatcccgcggtcgatctatcgacctctgttgag
cgcatcgtggatacgcacaagctgcgatgcgaaaccgcgcagcgcgatccgggcggcggg
ggcgtcaacgttgcgcgggtgctgcatcgcctcggcagcgaatgcgttgcgctgtttgcc
gcgggcggagtgacgggccgcatgcttggcggcatgctcgatggggagaaacttcgcact
cgctgtatcgacatcaaaggcgagacgcgagaaaacttctccgtgatggaaacgtcgacc
cggcgtgagtaccgattcgtgttgcctgggccaacgctcgcgccagcggagtggacggaa
tgtctgcgcagcgtgcaggcgcatgtcgattccgcgcgctttctcgtcctgagcggaagc
ctgcctcccggcgcaccggcggacgcctacgctcagctcgcgcgtgcggccgccactgca
cggccgaacattcgcgtggccgtggatgcgtcggggcccacgctcgcggcggccctcgct
ggcgggctcgtcgatatcgtcaagccgagtctgaatgaactacgcgaattgacggcactg
ccgctgaatgacgtgggggaccagatcgacgccgcaagaatgttgatcgtgcaacgcaag
gcgaggatggttgcactcacgcttgctgagcaaggcgcgatgctcgtgacgcacgacgaa
gcgtggttcatgcctgcgctgaaaacggaagtcctcagtgcaatcggcgcgggcgacagc
ttcctcgcgggattgatctggtcactcgaccatggagccgtcgccagcgaggcgctcgcc
tatgcggccgcagccgcggcggcggcgatgaagcaaacaggtacgcggctttgcgatgca
cgagacgtgacgcaggcttatgcaaagggcgaacgtgctgtacgggtacaggatcccgcg
cgctttcgcatcgtgcatcgcgagtcggcaccgtcaaggcagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system