KEGG   Burkholderia phymatum: Bphy_1351Help
Entry
Bphy_1351         CDS       T00704                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bph  Burkholderia phymatum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bph01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bph00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1517107..1518246
Genome map
AA seq 379 aa AA seqDB search
MSGTLALTETLIGRASVTPDDQNCQHLLVERLSAIGFECETIESNGVTNLWAVKRGAAGK
EGKLLAFAGHTDVVPTGPAEQWSSAPFEPTHRDGKLYGRGAADMKASIAGFVVASEEFVA
AHPQHRGSLALLITSDEEGPATDGTVKVVDALEARGERMDYCVVGEPTSSVRFGDMVKNG
RRGSMSGKLTVKGVQGHIAYPHLAKNPVHLLAPALAELVAEHWDEGNEYFPPTTWQVSNL
HSGTGATNIIPGHAEVMFNFRFSTASTVEGLQSRVHQILDKQGLDYDLTWTVSGLPFLTP
RGELSNALEKAIYDETGIATELSTTGGTSDGRFIARICKQVIEFGPLNASIHKIDEHIEV
AHIEPLKNVYRRVLEQLIA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcactcttgcccttaccgaaaccctgatcggccgcgcgtccgtcacgcccgac
gatcagaactgccagcaccttctggtcgagcgcctgtccgcgatcggcttcgaatgcgaa
acgatcgaatcgaacggcgtgacgaatctgtgggccgtcaaacgcggcgctgcgggcaag
gaaggcaagctgctcgcgttcgcgggccacacagatgtggtgccgacaggccccgccgaa
cagtggtcgtccgcgcccttcgagccgacccaccgcgacggcaagctgtacggccgcggc
gccgccgacatgaaggcgtcgattgcgggcttcgtggtcgcgagcgaggagttcgtggcc
gcgcatccgcagcatcgcggctcgctcgcgctgctcatcacgagcgatgaagaaggtccg
gcgacggacggcaccgtgaaggtcgtcgatgcgctcgaagcgcgcggggagcgcatggac
tactgcgtagtgggtgagccgacttcgagtgtgcggttcggcgacatggtgaagaacggt
cgccgcggctcgatgtcgggcaagctgaccgtcaagggtgtgcaaggccacatcgcgtat
ccgcatctggcgaagaacccggtgcacctgctcgcgcccgcgctcgccgaactggtcgcc
gagcactgggacgaaggcaacgaatacttcccgcccactacctggcaggtgtcgaacctg
cacagcggaacgggcgcgaccaacatcattcccggccacgccgaagtgatgttcaacttc
cgtttttcgacggcgagcacggtcgaaggcctgcaaagccgcgtgcatcagattctcgac
aaacagggtctcgactacgatctgacgtggaccgtgagtggcctgccctttctcacgccg
cgcggcgagctgtcgaacgcactcgaaaaagcgatctacgacgaaacgggcatcgcgacg
gaactgtcgacaacgggcggcacctcggatggccgtttcattgcgcggatctgcaagcag
gtcatcgaattcggtccgttgaatgcgagcatccacaagatcgacgaacatatcgaagtc
gcacatatcgagccgctcaagaacgtctaccgacgcgtgctcgaacaactgatagcctga

DBGET integrated database retrieval system