KEGG   Burkholderia phymatum: Bphy_1372Help
Entry
Bphy_1372         CDS       T00704                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bph  Burkholderia phymatum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bphy_1372
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bphy_1372
   00630 Glyoxylate and dicarboxylate metabolism
    Bphy_1372
Enzymes [BR:bph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bphy_1372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1540300..1541892
Genome map
AA seq 530 aa AA seqDB search
MANTLSLPQGMNITGEIKPGFEAILTPQALELVAALHRTFEPRRQQLLKLRAERAQRLDA
GERPDFLAGTRAIREGDWTIAPLPHDLQCRRVEITGPIERKMIINALNSGADSYMTDFED
SNAPSWDNQITGHINLKEAVRRTISLEQNGKSYRLNDRIATLIVRPRGWHLDEKHVTVDG
QRVSGGIFDFALFLHHNAKEQRSRGTGPYFYLPKMESHLEARLWNDIFVAAQEAVGVPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDKDFCLADRSQI
TMTVPFMRAYALQLLKTCHRRNAPAIGGMSALIPIKSDAAANDKAMTGVRSDKARDATDG
YDGGWVAHPGLVPIAMEEFVKVLGDKPNQIGKQRDDVQVTGKDLLDFRPEAPITEAGLRN
NINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLDDGRKVTAELV
RELTGQELDKVKAAIAGDTAPYVRAAQIFVDMSTSETFTEFLTLPLYEEL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacacgttgtcgctcccgcagggcatgaacatcaccggcgaaatcaagcccggc
ttcgaggcgattctgacgccccaggcactcgagctcgtcgccgccctgcaccggacattc
gagccgcgtcgccagcaactgctgaaactgcgcgccgaacgcgcgcagcgtctcgacgcc
ggcgagcgcccggattttctcgccgggacgcgagccatccgcgaaggcgactggaccatc
gcgccgctgccgcacgatctgcagtgccgccgcgtcgagatcacgggccccatcgagcgg
aagatgatcatcaacgcgctgaactcgggcgcagattcgtacatgaccgacttcgaggat
tcgaatgcgccgagctgggacaaccagatcaccggacacatcaacctgaaggaagcggtg
cgccgcacgatctcgctggagcagaacggcaagtcgtacaggctcaacgacaggattgcg
acgctgatcgtgcgtccgcgcggctggcatctggatgagaagcacgtcaccgtcgacgga
caacgggtatcgggcggcatcttcgacttcgcgctgttcctgcatcacaacgcgaaagag
caacgctcgcgcggcacgggtccctacttttacctgccgaagatggagagccatctggaa
gcgcgtctgtggaacgacatcttcgtcgcggcgcaggaagcggttggcgtgccgcgcggc
accatccgcgcaaccgtgttgatcgagacgatcctggctgcgttcgaaatggatgagatc
ctgtacgaactgcgtgaacacagctcaggcctgaacgccggacgttgggactacatcttt
tcggcgatcaagaagttcaagaacgacaaagatttttgcctcgcggatcgctcgcagatc
acgatgacggtgccgttcatgcgcgcatacgcgctgcagctgctgaagacatgccaccga
cgcaacgcgccagcgatcggcggcatgagcgcgctgatcccgatcaagagcgacgcggca
gccaacgacaaagcgatgaccggcgtgcgctccgacaaggcacgcgatgcgacggatggt
tacgacggcggctgggtcgcgcatcccggtctcgtgcccatcgcgatggaagaattcgtg
aaggtactgggcgacaagccgaatcagatcggcaagcagcgcgacgatgtgcaggtgaca
ggcaaggatctgctcgacttccgcccggaagcgcccatcaccgaggcggggttgcgcaac
aacatcaacgtcggcattcactacctgggttcgtggctcgcaggcaatggctgcgtgccg
attcacaacctgatggaagatgccgcgacggcggaaatctcgcgctcccaggtgtggcaa
tggatccgctcgccgaagggcaaactcgacgacggccgcaaggtaacggccgaactggtg
cgcgagctgacggggcaggaactcgacaaggtgaaggccgcgatcgcgggcgacaccgcg
ccgtacgttcgcgccgcgcagatcttcgtcgacatgtcgacgtcggagaccttcaccgag
tttctgacgctgccgctttacgaagaactctga

DBGET integrated database retrieval system