KEGG   Paraburkholderia phymatum: Bphy_1372Help
Entry
Bphy_1372         CDS       T00704                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00620  Pyruvate metabolism
bph00630  Glyoxylate and dicarboxylate metabolism
bph01100  Metabolic pathways
bph01110  Biosynthesis of secondary metabolites
bph01120  Microbial metabolism in diverse environments
bph01200  Carbon metabolism
Module
bph_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bphy_1372
   00630 Glyoxylate and dicarboxylate metabolism
    Bphy_1372
Enzymes [BR:bph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bphy_1372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACC70554
JGI: Bphy1372
UniProt: B2JIG0
Position
1:1540300..1541892
Genome map
AA seq 530 aa AA seqDB search
MANTLSLPQGMNITGEIKPGFEAILTPQALELVAALHRTFEPRRQQLLKLRAERAQRLDA
GERPDFLAGTRAIREGDWTIAPLPHDLQCRRVEITGPIERKMIINALNSGADSYMTDFED
SNAPSWDNQITGHINLKEAVRRTISLEQNGKSYRLNDRIATLIVRPRGWHLDEKHVTVDG
QRVSGGIFDFALFLHHNAKEQRSRGTGPYFYLPKMESHLEARLWNDIFVAAQEAVGVPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDKDFCLADRSQI
TMTVPFMRAYALQLLKTCHRRNAPAIGGMSALIPIKSDAAANDKAMTGVRSDKARDATDG
YDGGWVAHPGLVPIAMEEFVKVLGDKPNQIGKQRDDVQVTGKDLLDFRPEAPITEAGLRN
NINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLDDGRKVTAELV
RELTGQELDKVKAAIAGDTAPYVRAAQIFVDMSTSETFTEFLTLPLYEEL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacacgttgtcgctcccgcagggcatgaacatcaccggcgaaatcaagcccggc
ttcgaggcgattctgacgccccaggcactcgagctcgtcgccgccctgcaccggacattc
gagccgcgtcgccagcaactgctgaaactgcgcgccgaacgcgcgcagcgtctcgacgcc
ggcgagcgcccggattttctcgccgggacgcgagccatccgcgaaggcgactggaccatc
gcgccgctgccgcacgatctgcagtgccgccgcgtcgagatcacgggccccatcgagcgg
aagatgatcatcaacgcgctgaactcgggcgcagattcgtacatgaccgacttcgaggat
tcgaatgcgccgagctgggacaaccagatcaccggacacatcaacctgaaggaagcggtg
cgccgcacgatctcgctggagcagaacggcaagtcgtacaggctcaacgacaggattgcg
acgctgatcgtgcgtccgcgcggctggcatctggatgagaagcacgtcaccgtcgacgga
caacgggtatcgggcggcatcttcgacttcgcgctgttcctgcatcacaacgcgaaagag
caacgctcgcgcggcacgggtccctacttttacctgccgaagatggagagccatctggaa
gcgcgtctgtggaacgacatcttcgtcgcggcgcaggaagcggttggcgtgccgcgcggc
accatccgcgcaaccgtgttgatcgagacgatcctggctgcgttcgaaatggatgagatc
ctgtacgaactgcgtgaacacagctcaggcctgaacgccggacgttgggactacatcttt
tcggcgatcaagaagttcaagaacgacaaagatttttgcctcgcggatcgctcgcagatc
acgatgacggtgccgttcatgcgcgcatacgcgctgcagctgctgaagacatgccaccga
cgcaacgcgccagcgatcggcggcatgagcgcgctgatcccgatcaagagcgacgcggca
gccaacgacaaagcgatgaccggcgtgcgctccgacaaggcacgcgatgcgacggatggt
tacgacggcggctgggtcgcgcatcccggtctcgtgcccatcgcgatggaagaattcgtg
aaggtactgggcgacaagccgaatcagatcggcaagcagcgcgacgatgtgcaggtgaca
ggcaaggatctgctcgacttccgcccggaagcgcccatcaccgaggcggggttgcgcaac
aacatcaacgtcggcattcactacctgggttcgtggctcgcaggcaatggctgcgtgccg
attcacaacctgatggaagatgccgcgacggcggaaatctcgcgctcccaggtgtggcaa
tggatccgctcgccgaagggcaaactcgacgacggccgcaaggtaacggccgaactggtg
cgcgagctgacggggcaggaactcgacaaggtgaaggccgcgatcgcgggcgacaccgcg
ccgtacgttcgcgccgcgcagatcttcgtcgacatgtcgacgtcggagaccttcaccgag
tttctgacgctgccgctttacgaagaactctga

DBGET integrated database retrieval system