KEGG   Burkholderia phymatum: Bphy_1372Help
Entry
Bphy_1372         CDS       T00704                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bph  Burkholderia phymatum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bphy_1372
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bphy_1372
   00630 Glyoxylate and dicarboxylate metabolism
    Bphy_1372
Enzymes [BR:bph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bphy_1372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1540300..1541892
Genome map
AA seq 530 aa AA seqDB search
MANTLSLPQGMNITGEIKPGFEAILTPQALELVAALHRTFEPRRQQLLKLRAERAQRLDA
GERPDFLAGTRAIREGDWTIAPLPHDLQCRRVEITGPIERKMIINALNSGADSYMTDFED
SNAPSWDNQITGHINLKEAVRRTISLEQNGKSYRLNDRIATLIVRPRGWHLDEKHVTVDG
QRVSGGIFDFALFLHHNAKEQRSRGTGPYFYLPKMESHLEARLWNDIFVAAQEAVGVPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDKDFCLADRSQI
TMTVPFMRAYALQLLKTCHRRNAPAIGGMSALIPIKSDAAANDKAMTGVRSDKARDATDG
YDGGWVAHPGLVPIAMEEFVKVLGDKPNQIGKQRDDVQVTGKDLLDFRPEAPITEAGLRN
NINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLDDGRKVTAELV
RELTGQELDKVKAAIAGDTAPYVRAAQIFVDMSTSETFTEFLTLPLYEEL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacacgttgtcgctcccgcagggcatgaacatcaccggcgaaatcaagcccggc
ttcgaggcgattctgacgccccaggcactcgagctcgtcgccgccctgcaccggacattc
gagccgcgtcgccagcaactgctgaaactgcgcgccgaacgcgcgcagcgtctcgacgcc
ggcgagcgcccggattttctcgccgggacgcgagccatccgcgaaggcgactggaccatc
gcgccgctgccgcacgatctgcagtgccgccgcgtcgagatcacgggccccatcgagcgg
aagatgatcatcaacgcgctgaactcgggcgcagattcgtacatgaccgacttcgaggat
tcgaatgcgccgagctgggacaaccagatcaccggacacatcaacctgaaggaagcggtg
cgccgcacgatctcgctggagcagaacggcaagtcgtacaggctcaacgacaggattgcg
acgctgatcgtgcgtccgcgcggctggcatctggatgagaagcacgtcaccgtcgacgga
caacgggtatcgggcggcatcttcgacttcgcgctgttcctgcatcacaacgcgaaagag
caacgctcgcgcggcacgggtccctacttttacctgccgaagatggagagccatctggaa
gcgcgtctgtggaacgacatcttcgtcgcggcgcaggaagcggttggcgtgccgcgcggc
accatccgcgcaaccgtgttgatcgagacgatcctggctgcgttcgaaatggatgagatc
ctgtacgaactgcgtgaacacagctcaggcctgaacgccggacgttgggactacatcttt
tcggcgatcaagaagttcaagaacgacaaagatttttgcctcgcggatcgctcgcagatc
acgatgacggtgccgttcatgcgcgcatacgcgctgcagctgctgaagacatgccaccga
cgcaacgcgccagcgatcggcggcatgagcgcgctgatcccgatcaagagcgacgcggca
gccaacgacaaagcgatgaccggcgtgcgctccgacaaggcacgcgatgcgacggatggt
tacgacggcggctgggtcgcgcatcccggtctcgtgcccatcgcgatggaagaattcgtg
aaggtactgggcgacaagccgaatcagatcggcaagcagcgcgacgatgtgcaggtgaca
ggcaaggatctgctcgacttccgcccggaagcgcccatcaccgaggcggggttgcgcaac
aacatcaacgtcggcattcactacctgggttcgtggctcgcaggcaatggctgcgtgccg
attcacaacctgatggaagatgccgcgacggcggaaatctcgcgctcccaggtgtggcaa
tggatccgctcgccgaagggcaaactcgacgacggccgcaaggtaacggccgaactggtg
cgcgagctgacggggcaggaactcgacaaggtgaaggccgcgatcgcgggcgacaccgcg
ccgtacgttcgcgccgcgcagatcttcgtcgacatgtcgacgtcggagaccttcaccgag
tttctgacgctgccgctttacgaagaactctga

  All links  
No link information was found.   
DBGET integrated database retrieval system