KEGG   Burkholderia phymatum: Bphy_1720Help
Entry
Bphy_1720         CDS       T00704                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bph  Burkholderia phymatum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bphy_1720
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bphy_1720
  Amino acid metabolism
   00310 Lysine degradation
    Bphy_1720
Enzymes [BR:bph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bphy_1720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1957887..1959158)
Genome map
AA seq 423 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLAQV
IKNDGDIVTADEVIAKIDTEGKPGAAAVEAEVKPAPQAEPVAAAAAQAAAVAGASTAASP
AATKILAEKGVAASDVAGTGRDGRITKQDAVAAGAPAAKAAPAPAAAPARAAKPSLPQVG
APASAEQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDLRNKYKD
KFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVVP
ILRNADQMSLADIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPPQ
SAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDALEDPARLL
LDL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggctattgttgaagtcaaggtcccccagctgtccgagtcggtctcggaagccacgatg
ctgcagtggaagaagaagccgggtgaggctgtcgcccaggacgaaatcctgatcgaaatc
gaaaccgacaaggtcgtgctcgaagtgccggctccgtcggcaggcgtgctcgcgcaagtc
atcaagaacgacggcgacattgtcacggccgacgaagtgatcgcgaagatcgacacggaa
ggcaagccgggcgccgcggcggtcgaagccgaagtgaagccggctccgcaagctgaaccg
gttgctgccgccgcggcgcaagcggcagccgtggccggcgcaagcacggcggcatcgccg
gctgcgacgaagatcctggccgagaagggcgtggctgcgagcgacgtcgctggcacgggc
cgcgatggccgcatcaccaagcaggacgccgtcgccgccggcgcaccggcagccaaggct
gcaccggcaccggcagccgcgcccgcacgggctgcgaaaccgtcgctgccgcaagtgggc
gcaccggcatcggccgagcaatggctgaaggaccgcccggaacagcgcgtcccgatgtcg
cgtctgcgtgcgcgtatcgctgagcgcctgctcgagtcgcagcaaaccaacgccatcctc
acgacgttcaacgaagtgaacatggcgcccgtcatggatctgcgcaacaagtacaaggac
aagttcgagaaggaacatggcgtgaagcttggcttcatgtcgttcttcgtgaaggcggct
gtccacgcgctgaagaagttcccgctagtgaacgcgtcgatcgacgggaacgacatcgtc
taccacggctacttcgacatcggtattgccgtcggttcgccgcgcggtctggtggtgccg
atcctgcgcaacgccgaccagatgagcctcgccgatatcgagaagaagatcgccgaattc
ggccagaaggcgaaggacggcaagctgtcgatcgaagaaatgacgggcggcacgttctcg
atttcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccgccgcag
tcggccattctcggcgtgcacgcaacgaaggagcgcgcggtcgtcgaaaacggtcagatc
gtgatccgtccgatgaactatctggcgctgtcgtacgaccaccgcatcatcgacggccgc
gaagcggtgctgtcgctggtcgcgatgaaggacgcgctggaagatcccgcacgcctgctg
ctcgacctgtaa

DBGET integrated database retrieval system