KEGG   Paraburkholderia phymatum: Bphy_1747Help
Entry
Bphy_1747         CDS       T00704                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bph  Paraburkholderia phymatum
Pathway
bph03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bph00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bphy_1747
Enzymes [BR:bph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Bphy_1747
DNA repair and recombination proteins [BR:bph03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Bphy_1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Viral_helicase1 Helicase_RecD UvrD-helicase DUF2075 UvrD_C AAA_22 PIF1 AAA_25 CbiA MukB T2SSE AAA_29
Motif
Other DBs
NCBI-ProteinID: ACC70929
JGI: Bphy1747
UniProt: B2JKV2
Position
1:complement(1989853..1991871)
Genome map
AA seq 672 aa AA seqDB search
MSTFDQPLPDVKVNVPAPADFSTALAEGFARRVSALALRGGASEDAVRWAARAAFSASRA
TSEGHVCTSLDELAQRYEAEVAHVRCALLASGVASDGMQPAYALRPLVVDGQGRLYLARY
YDYERRLAQSLVDHARVEHEDGVSGEMSPHALRERLLRYFGPPQDEQIDWQRVAAVMALS
GRLTIVSGGPGTGKTTTVVGVLACLLDARPALRVALAAPTGKAAQRMQEALLARAGSLPP
ELAARLPHTSFTLHRLLGTGPDGRFRHHRENPLPYDVIVIDEASMIDVAMATHLFDALAR
DTHLVMLGDKDQLAAVEAGAVFGELSAQPAFTAQGVGSIAAALGIGERSLRDALPATAIC
HDARSDQAEPLFDDLFAMSSGAPSEAKPARLAPLADCVVWLERNYRFGLESAIGRLSLAI
RRGAAQEALDVMDIDPAVPCAAAFHEDMDAAPSEHTIHRLAAGFAAYADALTAALFSTSA
NAASHAPALFDALNRFRILCATRLGARGVDHMNAAMAAQVRRAARMPLAIGAQWFAGRPI
MVTRNDYALGLFNGDIGIALPGADGALRVFFRGADGALRAVSPAALPPHDTAFALTVHKS
QGSEFDHAVLMLPSTFSRVLSRELVYTAVTRARERVEVVGSRAVLMRAIATPTQRDSGLA
ARIAEAMEAGGR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacattcgatcagccgttgcccgacgtcaaggtcaatgttcccgcgcctgcggac
ttcagcacggcgctcgcggaaggtttcgcgcggcgggtgagtgcactcgcgctgcgcggc
ggtgcgtccgaagacgccgtgcgctgggccgcgcgggccgcgttcagtgcgagtcgcgcg
acatcggaaggacatgtgtgcacgtcgctggacgaactcgcgcaacgttacgaggccgag
gtcgcgcatgtgcgctgcgcgctgctcgcaagcggcgtcgcaagcgatggcatgcagccg
gcctatgcgctgcgaccgctcgtcgtcgacgggcaggggcgactctatctcgcgcggtac
tacgactacgagcgccggctcgcgcagtcactcgtcgatcacgcacgcgtcgagcatgag
gatggcgtgtccggcgagatgtcgccgcatgctttgcgcgaaagactgctgcgctatttc
ggtccgccgcaggacgagcagatcgactggcagcgcgtagccgccgtgatggcgctgtcg
gggcggctgacgatcgtcagcggcggtccgggcacgggcaagacgacgacggtggtgggc
gtgctcgcgtgcctgctggacgcgcgccccgctctgcgtgtcgcgcttgccgcgccgaca
ggcaaggctgcgcagcgaatgcaggaggcgctgctcgcgcgcgccggatcgttgccgccc
gaactcgccgcgcgtctgccgcacacctcgttcaccctgcaccggctgctgggtacgggg
ccggacgggcgtttccggcaccatcgcgagaatccgctgccctacgacgtgatcgtgatc
gacgaggcgtcgatgatcgacgttgcgatggcgacgcatctgttcgatgcgctcgcacgc
gacacgcatctcgtgatgctcggcgacaaggatcagctcgccgccgtcgaagcgggtgcg
gtattcggcgagttgagcgcgcagcctgctttcacggcacagggcgtcggttcgatcgcg
gccgcgctgggtatcggcgaacgctcgctgcgcgatgcactgcccgccaccgccatctgt
cacgatgcgcgttcagaccaggctgaacctttgttcgacgatctgttcgccatgtcctcc
ggcgcgccgtctgaagcgaaaccggcgcggctcgcgccgcttgcggattgcgttgtatgg
ctggagcgcaattaccgcttcggactggaatcggcgatcggccgtttgtcgcttgccatt
cggcgcggcgcagcacaggaagcgctcgacgtgatggacatcgatcccgccgtcccctgc
gcggccgcgtttcatgaagacatggacgctgccccttccgagcacacgatccaccgcctc
gccgctggcttcgctgcgtatgcggatgcgctgaccgccgcgctcttcagcacatcggca
aacgcggcgtcgcacgcgcccgcgctcttcgacgcgctcaatcgcttccgcatcctgtgt
gcgacgcgtctcggcgcacgcggcgtcgatcacatgaacgcggcgatggccgcgcaggtg
cgccgtgccgcgcgcatgccgctcgcgatcggtgcgcaatggttcgccggccgcccaatc
atggtgacgcgcaacgactatgcgctggggctgttcaatggcgatatcggcatcgcgctg
ccgggcgcggacggcgcgttgcgcgtcttcttccgcggcgcggacggcgctctgcgcgcc
gtgtcacccgccgcgctcccgccgcacgatactgcgttcgcgctcaccgtccacaagtcg
cagggctcggagttcgatcatgccgtgctgatgctgccgtccacattcagccgtgtgctg
tcgcgcgagctggtctatacggccgtgacgcgggcgcgcgagcgggtcgaagtggtcggc
tcgcgcgctgtgctgatgcgcgcgatcgcgacgccgacccagcgcgattcgggactggct
gcgcggatcgccgaggcgatggaagcgggtgggcgttag

DBGET integrated database retrieval system