KEGG   Burkholderia phymatum: Bphy_1747Help
Entry
Bphy_1747         CDS       T00704                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bph  Burkholderia phymatum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bph00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bphy_1747
Enzymes [BR:bph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Bphy_1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1989853..1991871)
Genome map
AA seq 672 aa AA seqDB search
MSTFDQPLPDVKVNVPAPADFSTALAEGFARRVSALALRGGASEDAVRWAARAAFSASRA
TSEGHVCTSLDELAQRYEAEVAHVRCALLASGVASDGMQPAYALRPLVVDGQGRLYLARY
YDYERRLAQSLVDHARVEHEDGVSGEMSPHALRERLLRYFGPPQDEQIDWQRVAAVMALS
GRLTIVSGGPGTGKTTTVVGVLACLLDARPALRVALAAPTGKAAQRMQEALLARAGSLPP
ELAARLPHTSFTLHRLLGTGPDGRFRHHRENPLPYDVIVIDEASMIDVAMATHLFDALAR
DTHLVMLGDKDQLAAVEAGAVFGELSAQPAFTAQGVGSIAAALGIGERSLRDALPATAIC
HDARSDQAEPLFDDLFAMSSGAPSEAKPARLAPLADCVVWLERNYRFGLESAIGRLSLAI
RRGAAQEALDVMDIDPAVPCAAAFHEDMDAAPSEHTIHRLAAGFAAYADALTAALFSTSA
NAASHAPALFDALNRFRILCATRLGARGVDHMNAAMAAQVRRAARMPLAIGAQWFAGRPI
MVTRNDYALGLFNGDIGIALPGADGALRVFFRGADGALRAVSPAALPPHDTAFALTVHKS
QGSEFDHAVLMLPSTFSRVLSRELVYTAVTRARERVEVVGSRAVLMRAIATPTQRDSGLA
ARIAEAMEAGGR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacattcgatcagccgttgcccgacgtcaaggtcaatgttcccgcgcctgcggac
ttcagcacggcgctcgcggaaggtttcgcgcggcgggtgagtgcactcgcgctgcgcggc
ggtgcgtccgaagacgccgtgcgctgggccgcgcgggccgcgttcagtgcgagtcgcgcg
acatcggaaggacatgtgtgcacgtcgctggacgaactcgcgcaacgttacgaggccgag
gtcgcgcatgtgcgctgcgcgctgctcgcaagcggcgtcgcaagcgatggcatgcagccg
gcctatgcgctgcgaccgctcgtcgtcgacgggcaggggcgactctatctcgcgcggtac
tacgactacgagcgccggctcgcgcagtcactcgtcgatcacgcacgcgtcgagcatgag
gatggcgtgtccggcgagatgtcgccgcatgctttgcgcgaaagactgctgcgctatttc
ggtccgccgcaggacgagcagatcgactggcagcgcgtagccgccgtgatggcgctgtcg
gggcggctgacgatcgtcagcggcggtccgggcacgggcaagacgacgacggtggtgggc
gtgctcgcgtgcctgctggacgcgcgccccgctctgcgtgtcgcgcttgccgcgccgaca
ggcaaggctgcgcagcgaatgcaggaggcgctgctcgcgcgcgccggatcgttgccgccc
gaactcgccgcgcgtctgccgcacacctcgttcaccctgcaccggctgctgggtacgggg
ccggacgggcgtttccggcaccatcgcgagaatccgctgccctacgacgtgatcgtgatc
gacgaggcgtcgatgatcgacgttgcgatggcgacgcatctgttcgatgcgctcgcacgc
gacacgcatctcgtgatgctcggcgacaaggatcagctcgccgccgtcgaagcgggtgcg
gtattcggcgagttgagcgcgcagcctgctttcacggcacagggcgtcggttcgatcgcg
gccgcgctgggtatcggcgaacgctcgctgcgcgatgcactgcccgccaccgccatctgt
cacgatgcgcgttcagaccaggctgaacctttgttcgacgatctgttcgccatgtcctcc
ggcgcgccgtctgaagcgaaaccggcgcggctcgcgccgcttgcggattgcgttgtatgg
ctggagcgcaattaccgcttcggactggaatcggcgatcggccgtttgtcgcttgccatt
cggcgcggcgcagcacaggaagcgctcgacgtgatggacatcgatcccgccgtcccctgc
gcggccgcgtttcatgaagacatggacgctgccccttccgagcacacgatccaccgcctc
gccgctggcttcgctgcgtatgcggatgcgctgaccgccgcgctcttcagcacatcggca
aacgcggcgtcgcacgcgcccgcgctcttcgacgcgctcaatcgcttccgcatcctgtgt
gcgacgcgtctcggcgcacgcggcgtcgatcacatgaacgcggcgatggccgcgcaggtg
cgccgtgccgcgcgcatgccgctcgcgatcggtgcgcaatggttcgccggccgcccaatc
atggtgacgcgcaacgactatgcgctggggctgttcaatggcgatatcggcatcgcgctg
ccgggcgcggacggcgcgttgcgcgtcttcttccgcggcgcggacggcgctctgcgcgcc
gtgtcacccgccgcgctcccgccgcacgatactgcgttcgcgctcaccgtccacaagtcg
cagggctcggagttcgatcatgccgtgctgatgctgccgtccacattcagccgtgtgctg
tcgcgcgagctggtctatacggccgtgacgcgggcgcgcgagcgggtcgaagtggtcggc
tcgcgcgctgtgctgatgcgcgcgatcgcgacgccgacccagcgcgattcgggactggct
gcgcggatcgccgaggcgatggaagcgggtgggcgttag

DBGET integrated database retrieval system