KEGG   Burkholderia phymatum: Bphy_1961Help
Entry
Bphy_1961         CDS       T00704                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bph  Burkholderia phymatum
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bph00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bph00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2205420..2206217)
Genome map
AA seq 265 aa AA seqDB search
MSSSNESLKGKVAVVTGAASGIGKQIALTLSAAGAAVAIADLNQDGANAVAEEINKAGGK
ALGIAMDVTNEDAVNQGIDKVAAELGSVDILISNAGIQIVNPIENYSFSDWKKMQAIHVD
GAFLTTKAALKHMYKDDRGGIVIYMGSVHSHEASPLKSAYVTAKHALLGLARVLAKEGAK
HNVRSHVVCPGFVRTPLVDKQIPEQAKELGITEEEVVRRVMLGGTVDGIFTTVEDVAQTV
LFLSSFPTAALTGQSFIVSHGWYMQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcatcgaatgagagtctgaaaggcaaggtcgccgtcgtcacgggtgcagcgagc
ggcatcggcaagcagatcgcgttgacgctgtcggcagcgggcgcggccgtcgcgatagcg
gacctgaaccaggacggcgcgaacgccgtcgctgaggagatcaacaaggcgggcggcaag
gcgctcggcattgcgatggacgtcacgaacgaagacgccgtcaaccagggcatcgacaaa
gtagccgcagaactcggctcggtggatatcttgatctcgaacgccggcatccagatcgtt
aatccgatcgaaaactactcgttttcggactggaagaagatgcaggctatccacgtggac
ggcgcattcctcaccacgaaggcagccctcaagcatatgtacaaggacgatcgcggcggc
atcgtgatctacatgggctcggtgcactcgcacgaagcgtcgccactgaagtcggcttac
gtgacggccaagcacgcgctgctcggcctggcgcgcgtgctcgcgaaggagggcgcgaaa
cataacgtgcgctcgcatgtcgtatgtccgggcttcgtgcgtacgccgctcgtcgacaag
cagattcccgagcaggcgaaagaactgggtatcacggaggaagaagtggtccgtcgcgtg
atgctcggcggtacggtagacggcatcttcaccacggtcgaagacgttgcgcaaacggtg
ctcttcctgtcgtcgttcccgactgcggcgctcacgggccagtcgttcatcgtcagccac
ggctggtacatgcaataa

DBGET integrated database retrieval system