KEGG   Paraburkholderia phymatum: Bphy_2011Help
Entry
Bphy_2011         CDS       T00704                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00010  Glycolysis / Gluconeogenesis
bph00051  Fructose and mannose metabolism
bph00562  Inositol phosphate metabolism
bph01100  Metabolic pathways
bph01110  Biosynthesis of secondary metabolites
bph01120  Microbial metabolism in diverse environments
bph01130  Biosynthesis of antibiotics
bph01200  Carbon metabolism
bph01230  Biosynthesis of amino acids
Module
bph_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bph_M00002  Glycolysis, core module involving three-carbon compounds
bph_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bphy_2011
   00051 Fructose and mannose metabolism
    Bphy_2011
   00562 Inositol phosphate metabolism
    Bphy_2011
Enzymes [BR:bph01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bphy_2011
Exosome [BR:bph04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bphy_2011
  Exosomal proteins of bladder cancer cells
   Bphy_2011
  Exosomal proteins of melanoma cells
   Bphy_2011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACC71190
JGI: Bphy2011
UniProt: B2JDN0
Position
1:complement(2261177..2261956)
Genome map
AA seq 259 aa AA seqDB search
MAKQRAKLVVGNWKMHGRLADNRVLLQAVSRGADDLPDDVRVGVCVPCLYLAQAQTLLES
GRVAWGVQDISAYTQGAYTGEVAAEMAAEFGATLAIVGHSERRAYHRESAEVVALKTQRA
LEAGLTPIVCVGETLEERECGKTEQIVGEQIDVVLAKLSVEDAARIVIAYEPVWAIGTGK
SATAQQAQDVHAFLRARLVAKGGDAANVSLLYGGSVKPENAEELFGQPDIDGGLIGGASL
KDKDFLAICSAAVAATAAR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacaacgagcaaaactggtagtcggtaactggaagatgcatggccggcttgcc
gacaatcgcgtgctgctgcaagcggtctcgcgcggcgcagacgatcttccggacgatgtg
cgggtgggtgtgtgtgtgccgtgcctctatctggcgcaggcgcaaacgctgctcgaaagc
ggtcgcgtcgcgtggggcgtgcaggatatctccgcgtacacgcagggcgcctacacgggc
gaagtcgcggccgagatggctgccgaattcggcgccacacttgcgatcgtcgggcactcc
gagcggcgtgcgtatcatcgcgaaagcgctgaggtcgtcgcgctgaagacgcaacgcgcg
ctcgaagcaggtttgacgccgatcgtctgcgtcggtgagacgctcgaagagcgcgaatgc
ggcaagacggagcagattgtcggcgagcagatcgatgttgtgctcgcgaaactgtcggtt
gaagatgccgctcgcatcgtcatcgcttacgagcctgtgtgggcgatcggcaccggcaag
agcgcgacggcgcagcaggcgcaagacgtgcacgcgtttctgcgcgcacgtctcgtggcg
aagggcggcgatgccgcgaacgtgtcgctgctgtacggcggcagcgtgaaaccggagaac
gcggaagagctgttcggccagccggacatcgatggcggtttgatcggcggagcgtcgttg
aaggacaaggatttcctggcaatctgcagtgcagctgtcgcggcaacggccgcgcgctga

DBGET integrated database retrieval system