KEGG   Burkholderia phymatum: Bphy_2011Help
Entry
Bphy_2011         CDS       T00704                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bph  Burkholderia phymatum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bphy_2011 (tpiA)
   01230 Biosynthesis of amino acids
    Bphy_2011 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bphy_2011 (tpiA)
   00051 Fructose and mannose metabolism
    Bphy_2011 (tpiA)
   00562 Inositol phosphate metabolism
    Bphy_2011 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bphy_2011 (tpiA)
Enzymes [BR:bph01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bphy_2011 (tpiA)
Exosome [BR:bph04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bphy_2011 (tpiA)
  Exosomal proteins of bladder cancer cells
   Bphy_2011 (tpiA)
  Exosomal proteins of melanoma cells
   Bphy_2011 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2261177..2261956)
Genome map
AA seq 259 aa AA seqDB search
MAKQRAKLVVGNWKMHGRLADNRVLLQAVSRGADDLPDDVRVGVCVPCLYLAQAQTLLES
GRVAWGVQDISAYTQGAYTGEVAAEMAAEFGATLAIVGHSERRAYHRESAEVVALKTQRA
LEAGLTPIVCVGETLEERECGKTEQIVGEQIDVVLAKLSVEDAARIVIAYEPVWAIGTGK
SATAQQAQDVHAFLRARLVAKGGDAANVSLLYGGSVKPENAEELFGQPDIDGGLIGGASL
KDKDFLAICSAAVAATAAR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacaacgagcaaaactggtagtcggtaactggaagatgcatggccggcttgcc
gacaatcgcgtgctgctgcaagcggtctcgcgcggcgcagacgatcttccggacgatgtg
cgggtgggtgtgtgtgtgccgtgcctctatctggcgcaggcgcaaacgctgctcgaaagc
ggtcgcgtcgcgtggggcgtgcaggatatctccgcgtacacgcagggcgcctacacgggc
gaagtcgcggccgagatggctgccgaattcggcgccacacttgcgatcgtcgggcactcc
gagcggcgtgcgtatcatcgcgaaagcgctgaggtcgtcgcgctgaagacgcaacgcgcg
ctcgaagcaggtttgacgccgatcgtctgcgtcggtgagacgctcgaagagcgcgaatgc
ggcaagacggagcagattgtcggcgagcagatcgatgttgtgctcgcgaaactgtcggtt
gaagatgccgctcgcatcgtcatcgcttacgagcctgtgtgggcgatcggcaccggcaag
agcgcgacggcgcagcaggcgcaagacgtgcacgcgtttctgcgcgcacgtctcgtggcg
aagggcggcgatgccgcgaacgtgtcgctgctgtacggcggcagcgtgaaaccggagaac
gcggaagagctgttcggccagccggacatcgatggcggtttgatcggcggagcgtcgttg
aaggacaaggatttcctggcaatctgcagtgcagctgtcgcggcaacggccgcgcgctga

DBGET integrated database retrieval system