KEGG   Burkholderia phymatum: Bphy_2195Help
Entry
Bphy_2195         CDS       T00704                                 

Definition
hypothetical protein
Organism
bph  Burkholderia phymatum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2470819..2471004
Genome map
AA seq 61 aa AA seqDB search
MYQSDITQFLNQLKQQKPTLEDEQRRGRALLWDKQPIDLDERASNQAARVKQTPYVYYQN
F
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaatcggatatcacgcagttcctgaatcaactgaagcagcaaaagcccactctg
gaagacgagcagcgccgcggccgcgccctgctgtgggacaagcagccgatcgacctcgac
gaacgcgcatccaatcaggcggcacgcgtgaagcagactccctacgtctactaccagaac
ttctaa

DBGET integrated database retrieval system