KEGG   Burkholderia phymatum: Bphy_2246Help
Entry
Bphy_2246         CDS       T00704                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bph  Burkholderia phymatum
Brite
Enzymes [BR:bph01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Bphy_2246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2520626..2521279
Genome map
AA seq 217 aa AA seqDB search
MNIEQARFNMIEQQIRPWEVLDQDVLNLLSIVKRENFVPAAYRELAFVDFEVPLPAGQHM
LAPRVEARVLQELAVKKHESVLEIGAGSGYMAALLAHRALHVLTVDIEPELAGLAKANLA
ANGVLNAEVATGDGARGWAAAAPYDIICVSGGLPVLPQEILEQLKVGGRLAAFVGTAPVM
KAQIITRVDEKQFRIADVFETYVEPLQNAVHAPRFKF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgaacaagcgcgtttcaacatgattgaacagcaaatccgtccgtgggaagtg
ctcgaccaggacgtgctgaatctgctgtcgatcgtcaagcgtgagaatttcgtgcccgcc
gcctatcgcgagctggcgttcgtcgatttcgaagttccgctgcccgccggacagcacatg
ctcgccccacgcgtcgaggcacgcgtgctgcaggaactggcggtcaagaagcacgagtcg
gtgctggaaatcggcgcgggttcgggctacatggccgcgctcctcgcgcaccgcgcactg
cacgtgctgacggtggatatcgagccagaactggccggactcgccaaggcgaatctcgcc
gcgaacggcgtgctgaatgccgaagtcgccacgggcgacggcgcacgcggctgggcggct
gccgcgccgtacgacatcatctgcgtgtcgggcggcctgcccgtcctgcctcaggaaatc
ctcgagcaactgaaggtcggtggccgcctcgccgcgttcgtcggcaccgcgcccgtgatg
aaggcgcaaatcatcacgcgcgtcgacgagaagcagttccgcatcgccgacgtgttcgaa
acctatgtcgaaccgctgcagaacgccgtgcacgcgccgcgcttcaagttctga

DBGET integrated database retrieval system