KEGG   Burkholderia phymatum: Bphy_2267Help
Entry
Bphy_2267         CDS       T00704                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bph  Burkholderia phymatum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bphy_2267
   00030 Pentose phosphate pathway
    Bphy_2267
   00051 Fructose and mannose metabolism
    Bphy_2267
   00052 Galactose metabolism
    Bphy_2267
   00500 Starch and sucrose metabolism
    Bphy_2267
   00520 Amino sugar and nucleotide sugar metabolism
    Bphy_2267
  Nucleotide metabolism
   00230 Purine metabolism
    Bphy_2267
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bphy_2267
Enzymes [BR:bph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Bphy_2267
    5.4.2.8  phosphomannomutase
     Bphy_2267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2540508..2541902)
Genome map
AA seq 464 aa AA seqDB search
MISQSIFKAYDIRGVIGKTLDAETARSIGRAFGSEVRAQGGDAVVVARDGRLSGPELIQA
LSDGLRSAGVDVVNVGMVPTPVGYFAASVPLKLDGGERRIDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGEQIQGLYKRITENRFESGNGTYQEYDIADAYLERITSDIKLARPLKLVVDT
GNGVAGGLAPRLFKALGCELVELFTEIDGNFPNHHPDPAHPENLQDVIRALKETDAEIGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNKGAQIIYDVKCTRNLAKWVKEKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILARVQDP
SALLNSLPNSHSTPELQLKLQEGENFELIARLQKSATFPDADQVVTIDGLRVEYPDGFGL
ARSSNTTPVVVMRFEADNDAALKRIQEDFRRVILAEKADAKLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctcgcaatccatattcaaggcatatgacatccgcggagtgatcggcaagacgctc
gacgccgagaccgcgcgttcgatcggccgcgcattcggcagcgaagtgcgcgcacagggc
ggcgatgccgtcgtcgttgcgcgtgacggacgtctgtccggtcccgaactgatccaggcg
ctgtctgacggcctgcgctcggcgggtgtcgacgtggtcaacgtcggcatggtgccgacg
cccgtcggctatttcgcagccagcgtgccgctcaagctggacggtggcgagcgccgcatc
gactcgtgcatcgtggtgacgggcagccacaatccgcccgactacaacggcttcaagatg
gtgctgcgcggcgcggccatctacggcgagcagattcaaggcctgtacaaacgcatcacc
gagaaccgcttcgagagcggcaacggcacgtatcaggagtacgacatcgccgacgcgtac
ctcgagcgcatcacgagcgacatcaagctcgcgcggccgctgaagctggtggtcgacacg
ggcaacggcgtcgcgggcggcctcgcgccgcgcctgttcaaggcgctcggctgcgaactg
gtcgaactgttcacggagatcgacggcaacttcccgaatcaccatccggacccggcgcat
cccgagaacctgcaggacgtgattcgcgcgctgaaggaaacggacgccgagatcggcttt
gcgttcgacggcgacggcgatcgtctgggcgtggtcacgaaggacggccagatcatttat
cccgaccgtcagctgatgctgttcgccgaagaagtgctgtcgcgcaacaagggcgcgcag
atcatttacgacgtgaagtgcacgcgtaatctcgcgaagtgggtcaaggagaagggcggc
gagccgttgatgtggaagacggggcactcgctggtgaaggcgaagctgcgcgaaacgggc
gcgccgctggcgggcgaaatgagcggccacgtgttcttcaaggaccgctggtatgggttc
gacgatggcttgtacacgggtgcgcgtctgctcgaaatcctcgcacgcgtgcaggacccg
agcgcgctgctcaacagcctgccgaattcgcattcgacgccggaattgcagctaaagctc
caggaaggcgaaaactttgaattgatcgcgcgtttgcagaagagcgcaacgtttcccgac
gccgatcaggttgtgacgattgacggcttgcgcgtcgagtatcctgatggattcgggctg
gcgcgctcgtcgaatacgacgcctgtcgttgtcatgaggtttgaggccgacaatgatgcg
gccttgaagaggattcaggaagacttccgccgtgtcattctggccgagaaggctgacgcg
aagttgccgttctga

DBGET integrated database retrieval system