KEGG   Paraburkholderia phymatum: Bphy_2317Help
Entry
Bphy_2317         CDS       T00704                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00521  Streptomycin biosynthesis
bph00523  Polyketide sugar unit biosynthesis
bph01130  Biosynthesis of antibiotics
Module
bph_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Bphy_2317
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bphy_2317
Enzymes [BR:bph01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Bphy_2317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACC71492
JGI: Bphy2317
UniProt: B2JFC4
Position
1:complement(2601735..2602286)
Genome map
AA seq 183 aa AA seqDB search
MAISVTATALPEVKIIEPKVFGDARGFFYESFNAREFAEKVEAGVEFVQDNHSRSAKGVL
RGLHYQIEHAQGKLVRVVEGEVFDVAVDVRKSSPTFGKWEGVLLSGDNHRQLWIPPGFAH
GFVVLSEAAQFLYKTTDYWFPEHERSIVWNDPEIGIEWPIDFEPVLAAKDAAGKRLSEAE
CFA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggccatcagtgtaactgcaacggcgcttcccgaagtcaagatcatcgagccgaaggtg
ttcggtgatgcgcgggggtttttctacgagagcttcaacgcgcgtgaatttgcagaaaag
gtcgaagcgggcgtcgagttcgtgcaggacaaccattcgcggtcggccaagggcgtgctg
cgcgggctgcattatcagattgagcatgcgcaaggaaaactcgtgcgcgtggtcgaaggt
gaagtgttcgacgtagcggtcgacgttcgcaagagttcgccgactttcggcaagtgggaa
ggcgtgctgctgtcgggcgacaaccatcggcagctttggattccacccgggttcgcgcat
ggtttcgtggtgttgtcggaggcggcgcagttcctctacaagacaaccgactactggttt
cctgaacacgagcgcagcatcgtctggaacgatccggagatcggcatcgaatggccgatc
gatttcgagccggtgctggccgccaaggacgcggccggaaagcgcctgagcgaagccgaa
tgctttgcatga

DBGET integrated database retrieval system