KEGG   Paraburkholderia phymatum: Bphy_2344Help
Entry
Bphy_2344         CDS       T00704                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00010  Glycolysis / Gluconeogenesis
bph00052  Galactose metabolism
bph01100  Metabolic pathways
bph01110  Biosynthesis of secondary metabolites
bph01120  Microbial metabolism in diverse environments
bph01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bphy_2344
   00052 Galactose metabolism
    Bphy_2344
Enzymes [BR:bph01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Bphy_2344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACC71519
JGI: Bphy2344
UniProt: B2JFF1
Position
1:2630663..2631754
Genome map
AA seq 363 aa AA seqDB search
MNLADMHSTDTSLSPSVQVERWGTLPGLGDVRLFTLRNAHGMRAAISDLGATLVSWHAPD
RAGRVADVLLGHDTPADYLASRWFFGSTIGRWANRIAQARFTLDGVTYQLDRNDGDNLLH
GGASGFHKALWQAREVDGALVLSHESPEGDAGFPGAVSATVRYALDDDGALTIDYDATAD
APTPVSLTNHAYFNLSGDALAEAPDIRGHVISIDADAFFAVDDTMIPIERREVAGSVFDF
RTGAPIGARLDWPDAQLARAGGFDHCYVLRDSGAALRTAATLYDPATGRELTVSTDARGM
QFYSGNFLADVNGRSGRTYGKHAALCLETGAFPNQVNMPDAEDVVLRPGARYRHTTVYRL
GVR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgccgacatgcacagcaccgacacttctctctcccccagcgtccaggtcgaa
cgctggggcacgttgcccggtcttggcgacgtccggctgttcacgctgcgcaacgcgcac
ggcatgcgcgcggccattagcgacctgggtgccacgctcgtttcgtggcatgcgcccgac
cgcgccggccgcgttgccgatgtgctgctcggccacgacacgcccgccgactatctcgcg
agccgatggttcttcggctcgaccatcggccgctgggcgaaccgtatcgcgcaggcgcgc
ttcacgctcgacggcgtgacctatcagctcgaccgcaacgacggcgacaatctgctgcac
ggcggcgcaagcggctttcacaaggcgttgtggcaggcgcgcgaagtggatggcgcgctc
gtgctgtcgcatgaatcgcctgaaggcgacgcgggctttccgggtgcggtgtcggctacc
gtgcgctatgcgctcgacgacgacggcgcactcacgatcgactacgacgcgacagccgat
gcgcccacacccgtcagcctgacgaatcacgcgtacttcaacctgtcgggcgacgcgctc
gccgaggcgccggacattcgcggccatgtgatttcgatcgatgccgacgcgttcttcgcg
gtcgacgatacgatgattcccatcgaacgcagggaggtggcgggaagcgtgttcgacttt
cgcacgggcgcccccatcggcgcacgcctcgactggcccgatgcgcaactcgcgcgcgcg
ggcggcttcgatcattgctacgtgctgcgcgacagcggcgcggccctgcgtacggctgcc
acgctgtacgatcccgcaaccggacgcgaactgacggtgtccacggacgcgagaggcatg
cagttctactcgggcaactttctcgcggacgtcaacgggcgcagcggcaggacgtatggc
aagcacgcagcgttgtgccttgaaacaggcgcgtttccgaatcaggtgaacatgcccgat
gccgaagacgtcgtgctgcgcccgggcgcgcgctatcgccacacgacggtctaccgcctc
ggcgtgcgctga

DBGET integrated database retrieval system