KEGG   Burkholderia phymatum: Bphy_2352Help
Entry
Bphy_2352         CDS       T00704                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bph  Burkholderia phymatum
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bphy_2352
Enzymes [BR:bph01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Bphy_2352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2638159..2640141)
Genome map
AA seq 660 aa AA seqDB search
MRLGVCYYPEHWPESMWEDDARRMKALGIEQVRIAEFAWSRMEPTPGEYDWGWLDRAVDV
LGKAGLQVVMCTPTATPPKWLIDRHPDILPVGADGRPRAFGSRRHYDFSSPSYFEASRKI
CTAVAGRYGKHPAVAYWQTDNEFGCHNTVVSYSPAAVARFREWLKARYQTIDALNRAWGT
VFWSMEYRSFDEIDAPIATVTEAHPSHRLDYRRFASDEVARYNRMQVEIIRAHSPGRPVA
HNFMQLFTEFDHYKVARDLDVATWDSYPLGALEEQWYAPEIKAKFLRTGHPDFASFNHDV
YRGMSKLPFWVMEQQPGPVNWAHWNPSPLPGMVRLWSWEAFAHGAGCVSYFRWRQAPFAQ
EQMHAGLNTPDNRLDVGGSEAQKVAHEIAQVSSANADADANVRSKIALIYDYEAKWLFEI
HPQGADFHYPRFAFEYYSALRALGFDVDVIAADAPFDGYKMIVVPPLPVVPDDFAVRLAA
SGAQIVLGPRTGSKTADLQIPPNLPPGALASLLPIRVWRVESMRPNVTEPVHMNGAGDGL
HEGHARHWRDLIDAADERGFDVRARFDDGHPAYVQHGCVHYFASLFDDALTQALFGRIAT
EAGLTPTLLGDSVRISRRGKLAYVFNYANAPHTIEGVDASRFVIGTREVEPQGVSAYRFE
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctaggagtctgttattacccggagcactggccggaatcgatgtgggaagacgac
gcgcgccgcatgaaagcgctcggcatcgagcaggtgcgaatcgcggagttcgcatggagc
cgtatggagcccacgcccggcgaatacgactggggctggctcgatcgcgccgtcgacgtg
ctcggcaaggctggcctgcaagtggtgatgtgcacgccgacggccacgccgccgaagtgg
ctgatcgaccgtcatcccgacattctgcccgtcggtgccgatggacgtccgcgtgcgttc
ggctcgcgccgtcactacgatttctcgtcgccgtcgtatttcgaagcgtcgcgcaagatc
tgcacggcagtggccgggcgctacggcaagcatcccgctgtcgcttactggcagacggat
aacgagttcggttgccacaacacggtggtcagctattcgcctgctgccgtcgcgcggttt
cgcgagtggctcaaggcgcgctatcagaccatcgacgcattgaaccgggcatggggcacg
gtgttctggagcatggagtaccgcagcttcgacgaaatcgatgcgcccatcgcgaccgtc
acggaagcgcatccttcccaccggctcgactatcgccgcttcgcgtcggatgaagtcgcg
cgctacaaccgcatgcaggtcgagatcattcgtgcgcattcgccgggccgtcccgttgcg
cacaacttcatgcagctcttcaccgagttcgatcactacaaggtcgcgcgcgatctcgac
gtggcgacgtgggacagctatccgctcggcgcactcgaagagcagtggtacgcaccggaa
atcaaggcgaagttcctgcgcacggggcatcccgacttcgcatcgttcaatcatgacgtg
tatcgcggcatgtcgaagctgccgttctgggtgatggagcagcagccagggcccgtgaac
tgggcgcactggaacccgtcgccgctgccgggcatggtgcgcctgtggagctgggaagcg
ttcgcgcacggcgcgggctgcgtgtcgtacttcagatggcgtcaggcgccgttcgcgcag
gagcagatgcacgcgggtctgaacacacccgacaatcgcctcgatgtcggcggcagcgaa
gcgcagaaggtcgcgcatgaaatcgcgcaggtgtcgtcggccaatgccgatgcggacgcg
aacgtgcgcagcaagatcgcgctgatctacgactacgaagcgaagtggctcttcgagatt
catccgcagggcgccgactttcactatccgcgctttgcgttcgaatattactcggcgctg
cgtgcgctcggctttgacgtcgatgtgattgccgccgatgcgccgttcgatggctacaag
atgatcgtcgtgccgccgctgcccgtcgtaccggacgatttcgccgtgcggctcgcggca
tcgggcgcgcagatcgtgcttgggccgcgtacgggttcgaagactgccgacttgcagatc
cccccgaacctgccgcccggcgcgctcgcgtcgctgctgccgatccgcgtgtggcgcgtc
gaatcgatgcggcccaacgtgacggaacccgttcacatgaacggcgccggcgacggactg
cacgaaggccacgcgcggcactggcgcgacctgatcgacgccgccgacgagcgcggcttc
gacgtgcgtgcgcgcttcgacgacggtcatcccgcgtacgtacagcatggctgcgtgcat
tatttcgcgagcctgttcgacgacgcgctcacgcaggcgctgttcgggcgcatcgcgacg
gaagccggcctcacgccgacactgctcggcgacagcgtgcgcatcagccgtcgcggcaag
ctcgcgtatgtcttcaactacgcgaacgcgccgcacacgatcgaaggcgtcgacgcatcg
cgcttcgtgatcggcacgcgtgaggtcgagccgcaaggcgtatctgcataccgattcgag
tag

DBGET integrated database retrieval system