KEGG   Burkholderia phymatum: Bphy_2378Help
Entry
Bphy_2378         CDS       T00704                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bph  Burkholderia phymatum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bphy_2378
Enzymes [BR:bph01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Bphy_2378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2670365..2671531
Genome map
AA seq 388 aa AA seqDB search
MRRKRLLTQRFARIPKCGAVRRLVGLAVACLQVSVAAHADCRWPLWERYAQQQISKDGRI
VEPGKGDRTTSEAQAYAMFFAVVGDDRVRFDSLLNWALAHTWATTGHPPAWLWAKRADGT
FDVLDDNSATDADLWMAYAMLEAARRWSEPRYRALGLRLLDQITATEVVWQDETSAFLIP
GRLGFRLSEHAYLVNPSYAPIQLLRRFIKEQPHGPWVSVLNHQVDLLVASAPQGFVPDWY
RFDTFKGYMLEPSKGPTGGFDAVRTYMWAGMLDPTDPARGEVIPALSGMADLVAQTGRMP
LYVNIESGETFDEGSAGFRAAVIPLLFVTGHPSAASRLAQETKVMQQAREWDGLHYYDRN
LLLFAAGWLEGRYRFDHEGTLQLKPCRP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaggaaaagattactcacgcaaaggtttgctcgaatcccaaaatgtggcgccgtg
aggcgccttgttgggctcgcggtggcttgcctgcaggtcagcgttgccgcacacgccgat
tgtcgctggcccttatgggagcgctacgcgcagcaacagatctcgaaagacggacgcatc
gttgagccgggaaaaggcgatcgcacgacctctgaggcacaggcctatgcaatgttcttt
gcagtggtgggggacgatcgggtgcgattcgacagcttgctcaactgggcgctcgctcac
acgtgggcgacgacgggacaccctcccgcgtggctatgggcgaagcgtgccgacggcacc
ttcgacgtcctcgacgacaattcggctacggatgccgacctctggatggcttatgcaatg
ctcgaggcggcgaggcggtggtcggagccgcgctaccgtgcacttggtctgcggctgctc
gatcagatcacggccaccgaggtcgtgtggcaggacgagacatcagcctttctcattcca
ggtcggctcggtttccggttgagtgaacatgcatatttggtgaatcctagctacgcgccg
atccagcttcttcgccgcttcataaaagaacagccgcacggaccttgggtatcggtcttg
aaccatcaggtcgatctcctggtcgccagtgccccgcaggggttcgttccagattggtat
cgcttcgacacattcaaaggctacatgctcgaaccaagcaaagggccgaccggtggcttt
gatgcggtacgaacgtacatgtgggcgggcatgcttgacccgacggatcccgcgcgtggc
gaagtcattccagccttgtccggtatggcggacctggttgcacagacaggccgcatgccg
ctttacgtcaacatcgaatcgggcgagaccttcgatgaaggttcagccgggtttcgggct
gcggtcattccattgttattcgtgaccgggcacccgagcgcagccagtcggctcgcacag
gagacgaaagtcatgcaacaggcgcgtgagtgggatggtctccattattacgatcgcaac
ctgctgttgtttgcagcaggctggctggaaggcaggtatcgtttcgatcacgagggcaca
ctacaactcaagccgtgcaggccttga

DBGET integrated database retrieval system