KEGG   Burkholderia phymatum: Bphy_2399Help
Entry
Bphy_2399         CDS       T00704                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
bph  Burkholderia phymatum
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:bph01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bph00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bph00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2695779..2696591)
Genome map
AA seq 270 aa AA seqDB search
MARTKESLRRTAASSDEKILAIDIGGTGLKAAVIDAGGEMKSERARVATPHPCTPEQLVD
TLAKLVQPLIDAHRPTLMSIGFPGVVRDNRVLTAPNIGDPGWRGFALADQLAARVGGLPV
RMINDAEMQGFAAIEGRGLEFVLTLGTGAGTALFRDGELMPHLELAHHPVSKGRTYDEYI
GNAAREKAGNKRWNRRVEKVIGILASLVNYDKLWIGGGNAGRLTFELPSDAAIVSNAAGI
EGGAKLWHPKSVRETRQLPEANRNAGPFAK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
ttggccaggactaaagaatcgttgcgacgcacagccgccagcagcgacgaaaagatactc
gcgatcgacattggcgggacgggcctgaaggccgccgtgatcgacgcgggcggcgagatg
aaaagcgagcgtgcgcgcgtggcgacaccgcatccgtgcacgccggagcaactggtcgat
acgctcgcgaagctcgtgcagccgcttatcgacgcgcatcgtccgacgctgatgtcgatc
ggctttccgggcgtcgtgcgggacaaccgagtgctgactgcacctaatatcggcgatccg
ggctggcgcggctttgcgcttgcggaccagcttgccgcgcgtgtcggcggcttgcccgtg
cgcatgatcaacgatgccgagatgcagggcttcgccgcgatcgaaggacgcggcctcgaa
ttcgtgctgacgctaggaaccggcgcgggtacggcgctctttcgcgacggcgaactgatg
ccgcacctcgaactcgcgcatcatcccgtcagcaagggacgcacgtatgacgagtacatc
ggcaatgcggcgcgcgagaaggcgggcaacaagcgctggaaccggcgcgtcgagaaggtg
atcggcatcctggcttcgctcgtcaattacgacaagctgtggatcggcggcggcaatgcc
gggcgcctgacattcgagttgccttccgatgcggccatcgtgtcgaatgcggcgggcatt
gaaggcggcgcgaaactgtggcatccgaaatcggtgcgcgagacgcggcagttgcctgaa
gcgaaccggaacgcggggccgttcgcgaaatga

DBGET integrated database retrieval system