KEGG   Burkholderia phymatum: Bphy_2492Help
Entry
Bphy_2492         CDS       T00704                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bph  Burkholderia phymatum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bphy_2492
Enzymes [BR:bph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Bphy_2492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2803061..2803651
Genome map
AA seq 196 aa AA seqDB search
MTVAYLGLGANLGDARQTLKDAVVCLAQQHTITVLAKSSLYRTAPIDAGGDDYLNLVVKL
DTSMPVRHLLALCHKIEHHFGRERPFRNAPRTLDLDILLYGEHAIDEPDLIVPHPRMTER
AFVLVPLVEIEPALIIPQRGRADAFLPGVAGQRIEKMKSPCQCLASNASNAANASDAAGT
LGMADNGDDAPKGGCR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgcctatctcggcctcggcgcgaatctcggggacgcgcgccagaccctgaaa
gacgcggtggtgtgtctcgcacaacagcacaccatcaccgtgctcgcgaaatcgagcctt
tatcgaaccgccccgatcgacgcgggcggcgacgactatctgaatctcgtcgtcaagctc
gacacctcgatgcccgtgcggcatctgctcgcgctgtgccacaagatcgagcatcacttc
ggccgggaacgtccctttcgcaatgcgccgcgcacgcttgatctcgacattctgctgtat
ggcgaacacgccatcgacgaacccgatctgatcgtgccgcatccgcgcatgacggagcgc
gcattcgtgctcgtgccgctcgtcgaaatcgaaccggcgctgatcattccgcaacgcggc
cgcgccgatgcgtttctgccaggcgtcgccggtcagcgcatcgagaagatgaaatctccc
tgccagtgcctcgcgtccaatgcgtccaatgcggccaacgcgagcgacgcagccggcacg
ctcggcatggcagacaacggggacgacgcacccaaaggcggctgccgatga

DBGET integrated database retrieval system