KEGG   Burkholderia phymatum: Bphy_2603Help
Entry
Bphy_2603         CDS       T00704                                 

Definition
guanine-specific ribonuclease N1 and T1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bph  Burkholderia phymatum
Brite
Enzymes [BR:bph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Bphy_2603
Transfer RNA biogenesis [BR:bph03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Bphy_2603
 Prokaryotic Type
    Bphy_2603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2941326..2941727)
Genome map
AA seq 133 aa AA seqDB search
MARKWLRDGVLIAALTVGGLVGGFSSGAWAREAQEGQGGGTIAAAQLPPEAVSTLNLIAA
GGPYPYEKDGVVFGNRERLLPSHRRGYYHEYTVPTPGARDRGARRIVCGGPLRRTSNCYY
SDDHYASFNRIIE
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagtggctccgcgacggcgtgctgatcgccgccttgacggtcggcggtctt
gtcggcggtttttcgtcaggcgcctgggctcgggaagcgcaagagggacagggcggaggc
accatcgcggcggcgcaattgccgcccgaagccgtcagtacattgaacttgattgcagcc
ggcgggccttacccgtatgagaaggacggcgtcgtattcggcaatcgtgaacggttgctg
ccgtcgcaccggcgcggctattaccacgaatacaccgttcccacgccaggcgcccgcgat
cgcggcgcacgccgcatagtctgtggagggccgctgaggcggaccagcaattgttattac
tcagacgaccactacgccagttttaatcgcatcattgaatga

DBGET integrated database retrieval system