KEGG   Burkholderia phymatum: Bphy_2706Help
Entry
Bphy_2706         CDS       T00704                                 

Definition
putative thiol-disulfide interchange protein, DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bph  Burkholderia phymatum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3059761..3060486)
Genome map
AA seq 241 aa AA seqDB search
MKKSIRIAALALAVATLGLGCSAQADQTTDKLKSTLQARLSEATIKNVSKSPIDGLYEVN
LGSQIIYSDASGDHLILGDMIDAKTRKNLTEARLSETNRIDFASLPFANAVKVVKGNGSR
KIAVFSDPNCPYCKQLETTLKSMDNITVYTFLYPVLSPDSTVKSKSIWCSADRAKAWESW
MQDHRAPTAPGTCDTAAIDRNLALGQSMNVSGTPTVFLADGRRLPGAVPADELDKALSSV
R
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatctatccgcatcgcggcgctggcgctggccgttgcgaccctcggactcggc
tgttcggcccaggccgaccagaccaccgacaaactcaagtcgacgctgcaagcgcgtctg
agcgaagcaacgatcaaaaacgtgtcgaagtcgccgatcgacgggctgtacgaagtgaac
ctcggctcgcagatcatctacagcgatgcgtcgggcgaccatctgatcctcggcgacatg
atcgacgcaaagacgcgcaagaatctgacggaagcgcgtctgtccgaaaccaatcgcatc
gatttcgcgagcctgccgttcgcgaatgcggtgaaagtggtgaagggcaacggtagccgc
aagatcgccgtgttttccgatccgaactgcccgtactgcaagcagctcgaaacgacgctg
aagtcgatggacaacatcacggtctacaccttcctgtacccggtgctgtcgccggattcg
acggtgaagtcgaagtcgatctggtgttccgccgaccgtgcgaaggcgtgggaatcgtgg
atgcaggatcaccgcgcgccgaccgcgccgggcacctgcgacacggccgcgatcgacagg
aatctcgcgctcggccagtcgatgaacgtgagcgggacgccgaccgttttcctcgcggac
ggccgccgcctgcccggcgcggttcccgccgacgaactggacaaggcgttgtcgtccgtg
cgctga

DBGET integrated database retrieval system