KEGG   Burkholderia phymatum: Bphy_2969Help
Entry
Bphy_2969         CDS       T00704                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bph  Burkholderia phymatum
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bph00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bphy_2969
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Bphy_2969
Enzymes [BR:bph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Bphy_2969
Two-component system [BR:bph02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Bphy_2969
Bacterial motility proteins [BR:bph02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Bphy_2969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3326085..3327188)
Genome map
AA seq 367 aa AA seqDB search
MQKIKVLCVDDSALIRSLMTEIINSQPDMTVVATAPDPLVARELIKQHNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGAVDFVTKPKVGIRDGMLDYS
EKLADKIRAAARARVRQAAPAQHAPASSAQAGAAAHAASPAPLFNNPLVSTEKLIIVGAS
TGGTEAIREVLVPLPPDAPAVLIAQHMPPGFTKSFAQRLNGLCRITVKEAEHGERVLPGH
AYIAPGHAHLLLARSGANYIAHLSDDPPVNRHRPSVDVLFRSAAQHAGKNAVGVILTGMG
RDGAAGLLDMRKAGAYTLAQDEASCIVFGMPREAIAMGAADEIASLSEMSRRVMTRLATM
GDRVQRV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaaagatcaaagtattgtgcgtcgacgattcggcgttgattcgtagcttgatgacg
gaaatcatcaatagtcagcccgacatgacggtcgtcgcaaccgcgccggatccgctcgtc
gcgcgtgagctcatcaagcagcacaaccccgacgtgctgacgctcgatgtcgaaatgccg
cgcatggacggcctcgacttcctcgaaaagctgatgcgtctgcgtccgatgcccgtcgtg
atggtgtcgtcgttgaccgagcgcggctcggaaatcacgctgcgcgcgctcgaactgggc
gccgtcgatttcgtcacgaagccgaaggtgggcattcgcgacggcatgctcgactactcg
gaaaagctcgccgacaagatccgcgccgcagcccgcgcgcgcgtgcgccaggccgcgccc
gcgcagcatgcgccggcgtcgtccgcgcaggccggcgcggcggctcacgctgcatcgcct
gcgccgctcttcaacaacccgctcgtgtcgacggaaaagctgatcatcgttggcgcttcg
acgggtggcacggaagcgatccgcgaagtgctggtgccgctgccgcccgatgcgcccgct
gtgctcattgcgcagcacatgccgcccggttttacaaaatctttcgcacaacgccttaat
ggtttgtgccggattaccgttaaagaagctgagcacggcgaacgcgtgttgccgggtcat
gcgtacatcgcgcctggtcacgcacaccttttgctcgcccgtagcggcgccaactatatt
gcgcatctgtcagacgacccgcccgtcaaccggcatcgtccgtctgtcgatgtgttgttc
cgctcggcggcgcagcatgcggggaagaacgccgtcggcgtgattctcacgggcatggga
cgcgacggcgcggcgggtttgctggacatgaggaaagccggcgcgtacacgctcgcgcag
gacgaagcgagctgcatcgtgttcggcatgccgcgcgaggcgatcgcgatgggggccgct
gacgaaatcgcgtcgctgtcggagatgagccggcgcgtgatgacccgtctggcgacaatg
ggtgatcgggttcagcgcgtatga

DBGET integrated database retrieval system