KEGG   Burkholderia phymatum: Bphy_3511Help
Entry
Bphy_3511         CDS       T00704                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bph  Burkholderia phymatum
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bph00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bph00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:bph00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:bph00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:bph00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(447581..448528)
Genome map
AA seq 315 aa AA seqDB search
MKRKLKVAIIGSGNIGTDLMIKILRHGEHIEMGAMVGIDAASDGLQRAARLGVVTTHEGV
EGLSRMPVFADIDIVFDATSASAHTRNDAFLRAIKPGIRFVDLTPAAIGPYCIPVVNGER
HLDAPNVNMVTCGGQATIPMVAAVSRVARVRYAEIVASISSRSAGPGTRANIDEFTETTS
RAIEVVGGAAVGKAIIVLNPAEPPLIMRDTVYTLSEFVDERQIEESVTRMAEAVQTYVPG
YRLKQRVQFDRIDADGPIRIPGISDRMVGLKTSIYLEIEGAAHYLPAYAGNLDIMTSAAK
VTAEGVANRLLANKK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggaaactgaaggtcgccattatcggcagcggcaacattggcactgatctcatg
atcaagattttgcgacacggcgagcacatcgagatgggcgcgatggtgggaatcgacgca
gcatcggacggactccagcgcgctgcgcgcctcggggtggtcacgacgcacgagggcgtc
gaagggctcagtcgaatgccagtgttcgcggatatcgatatcgttttcgacgcaacgtcc
gcctcggcgcacacgcgcaatgacgcgttcctgcgcgccatcaagcccggcatccgcttc
gtggatctgactccggcggccatcggcccgtattgcatcccggtggtgaacggtgagcgc
caccttgatgcgcccaatgtcaacatggtgacttgtggtggtcaggcaaccattccgatg
gtcgccgctgtatcgagggtcgcgagagtccgttacgccgagatcgttgcttccatctcg
agcaggagcgccgggcccggcacgcgcgccaacatagatgagttcaccgagactacgtcc
cgggcaatcgaggtggtgggtggtgcggccgtgggcaaggcgatcatcgttctcaacccg
gcggaaccgccgctgatcatgcgcgatacggtgtacacgctcagtgaattcgtcgatgaa
cgccagatcgaggaatcagtgacccgcatggcggaggcggtccagacatacgtgcccggc
taccgtctgaagcagcgcgtgcagttcgaccgcatcgacgccgatgggccgatccggatt
ccgggcatcagcgaccgcatggtcggcctcaaaacctcgatttacctcgaaatcgagggc
gcggctcactatctgcccgcttacgccggcaacctcgacatcatgacgagtgccgcgaag
gtcacggccgagggagtcgccaaccgccttctggccaacaaaaagtga

DBGET integrated database retrieval system