KEGG   Burkholderia phymatum: Bphy_3756Help
Entry
Bphy_3756         CDS       T00704                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bph  Burkholderia phymatum
Brite
Enzymes [BR:bph01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Bphy_3756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:716377..717819
Genome map
AA seq 480 aa AA seqDB search
MSSQKSALPPSLPAGDAQRAAGAKHHLLRALGWTAAVIAAGCVAFVAYAAIYPERMPLAI
GTIVEDFTGANPQPVVLHVPPSQPLSAVALLGKQIFNDPSLSASGKQSCASCHSPDHAYG
PPNDLSVQLGGPHMTDAGYRPPPSLAYLYRQAPFSIGPDQNDMDAGPATLDQLATAASGA
QRAAKSAGVTPAAPALVPQGGLFWDGRASTLQDQALGPLLNPVEMANKNTDEVVHKLLNA
KYLDQFKQLFGERILQQPDLLVDEAMFAVGRYEFEDPSFHRFTSKYDYWLQGKARLTQAE
LHGLRLFNDPDKANCAGCHLSKPTADHLPPLFTDTQYEALGVPRNRDLPVNRDPKFYDMG
VCGPFRTDASALTQYCGMFLTPTLRNVATRHAFFHNGVYHDLKQVMDFYNLRNTSPEKIY
PLDAAGKPQKYDDLPEKYRANIDVADAPFDRKPGDKPAMTDDEVKDLIAFMNTLTDGYKP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagctctcaaaagtccgcattgccgccctcactgcccgccggcgatgcacagcgcgcc
gccggcgccaaacaccacctgctgcgcgcgcttggctggacggctgccgtcattgcggcc
ggctgcgtcgcattcgtcgcctatgcggcgatctatccggagcggatgcctcttgcgatc
ggcaccatcgtcgaagatttcaccggcgcgaatccgcagccggtcgttcttcatgtgccg
ccgagccaaccgctgagcgcagtcgccctgctcggcaagcagatcttcaacgacccgtcg
ctgtcggcgtcgggcaagcagtcgtgtgcgtcgtgccacagccccgaccatgcatacgga
ccgccgaacgatctctccgtgcaactcggcggtccgcatatgacggacgccggctaccgg
ccgccgccgtcgcttgcatacctgtatcgccaggcgccgttctcgatcggccccgatcag
aacgatatggacgcggggcccgccacgctcgaccagctcgcgaccgcggcaagcggcgcg
caacgcgcggcgaagtcggcgggcgtcacgcctgccgcgcccgcgctcgtgccgcaaggc
ggtctcttctgggacggccgcgccagcacgctgcaggatcaggcgctcggtccgctgctg
aaccccgtcgaaatggccaacaagaacacggacgaagtcgtgcataagctgttgaacgcg
aagtatctcgaccagttcaagcagctgttcggcgagcggattctgcagcagcccgatctg
ctcgtcgacgaggcgatgttcgccgtcggacgctacgagttcgaagacccgtcgtttcat
cgcttcacgagcaagtacgattactggctgcagggcaaggcgcgcctcacgcaagcggaa
ctgcacggcttgcgcctgttcaacgatccggacaaggcgaactgtgcgggctgccacctg
agcaagccgacggccgatcatctgccgccgctcttcaccgacacgcagtacgaagcgctc
ggcgtgccgcgcaaccgcgacctgcccgtcaacagagatccgaagttctacgacatgggc
gtatgcggccccttccgtacggacgcgtctgcgttgacgcaatactgcggcatgttcctg
acgccgacgctgcgcaacgtcgcgacgcgccatgcgttctttcataacggcgtgtatcac
gacctgaaacaggtgatggacttctacaacttgcgcaacaccagccccgagaagatttat
cccctcgacgctgcaggcaaaccgcaaaagtacgacgatcttccggagaagtaccgcgcg
aatatcgacgtcgccgacgcgccgttcgatcgcaagccgggcgacaagccggcaatgacc
gacgatgaggtcaaagacctcatcgcattcatgaacacactgacggacggatacaagcct
taa

DBGET integrated database retrieval system