KEGG   Burkholderia phymatum: Bphy_4374Help
Entry
Bphy_4374         CDS       T00704                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bph  Burkholderia phymatum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bphy_4374
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bphy_4374
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bphy_4374
Enzymes [BR:bph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bphy_4374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:1402540..1403733
Genome map
AA seq 397 aa AA seqDB search
MYNLPDERGHFGQYGGVFVAETLVHALDELRVAYAKYSQDPDFIAEYERELKYFVGRPSP
VYHAQRWSELLGGAQVYLKREDLNHTGAHKVNNVIGQALLARRMGKPRVIAETGAGQHGV
ATATIAARFGMECIVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNVENTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPELTGRQPDAVIACVGGGSNA
MGIFYPYIDDKSVKLIGVEAAGDGIDTGRHAASLMGGSPGVLHGNRTYLLQDENGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAEYVGITDEEALKAFHDCCRIEGIIPALESSHALAY
AAKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGIQF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaatttacccgatgaacgtggccatttcggccaatatggcggcgtgttcgtcgcc
gaaacgcttgttcacgcgcttgatgaactgcgcgtagcgtacgcgaaatattcccaagac
ccggactttatcgccgaatacgagcgcgagctgaagtactttgtcggtcgtccttcgccc
gtttatcacgcacaacgctggagcgaactgctgggtggcgcgcaggtgtatctgaagcgc
gaagacctgaaccatacgggtgcgcacaaggtgaacaacgtgatcggccaggcgctgctg
gccaggcgcatgggcaagccgcgggtgattgcggagacgggcgcgggccagcatggcgtg
gcgacggcgaccattgcggcgcgtttcggcatggagtgcatcgtgtacatgggcgcggaa
gacgtgcgccgtcaggcggcgaacgtttaccgcatgaaacttctcggcgcgaccgttgtg
cccgtcgagtccggctcgcgcacgctgaaggatgcgctgaacgaagcgatgcgcgactgg
gtcacgaacgtcgagaacaccttctacatcatcggcacggtcgccggtccgcatccttat
ccgatgatggtgcgcgatttccagcgcgtgatcggcgatgagtgcaaggtgcagatgccg
gagttgacgggccgtcagccagacgccgttatcgcgtgcgttggcggcggttcgaatgcg
atgggcatcttttacccgtacattgacgataagtcggtgaaactgatcggcgtcgaagcc
gccggcgacggcatcgacacaggtcgacacgcggcctcgctgatgggcggcagtccgggg
gtgctccacggcaatcgcacctatctcctgcaggacgagaacggccagatcatcgagacg
cattccgtgtcggcgggtctcgactatccgggcgtcgggcctgagcacgcgtggctcaag
gacagcggccgcgccgaatatgtcggcatcaccgacgaagaagcgctcaaggcgtttcac
gactgctgccgtatcgaaggcatcattcctgcgctcgagtcgagccatgcgctcgcgtac
gcggcgaagctcgcgccgaccttgccgaaggacaagatccttctggtgaacctgtcgggc
cgcggcgacaaggacatgcacacggtcgcggagcgatcgggcatccagttctga

DBGET integrated database retrieval system