KEGG   Paraburkholderia phymatum: Bphy_4376Help
Entry
Bphy_4376         CDS       T00704                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bph  Paraburkholderia phymatum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bphy_4376
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bphy_4376
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bphy_4376
Enzymes [BR:bph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bphy_4376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:1404695..1405510
Genome map
AA seq 271 aa AA seqDB search
MSRIQSTFAALAAQGKKGLIPFMTAGDPDPARTVEFMHALAKGGADVIELGVPFSDPMAD
GPVIQQSSERALAKGVSLRHVLADVKRFRESDDKTPVVLMGYANPIERMGADAFAAAAKD
AGVDGVLVVDYPPEESANFAETMKAAGIDPIFLLAPTSTDERIAEVGKIASGYVYYVSLK
GVTGAANLDVLSIAGKIPAIKSRVPLPVGVGFGIRDAQSARAVAEVSDAVVIGSRIVQLL
EEAAPQSAAGKLTNFIKEIRQALDSIGATAG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtattcaatcgacgttcgcggccttggccgcgcagggtaagaaaggtctgatt
ccattcatgactgccggcgatcccgacccggcgcgcacggtcgagttcatgcacgcgctc
gccaagggcggcgccgatgtcatcgaactcggcgtgccgttttccgacccgatggcagat
gggcccgtgattcagcagtcgtcggagcgggcgctggcgaagggcgtgtcgctcaggcac
gtgctggccgatgtcaagcgcttccgcgaaagcgacgacaagacgcccgtcgtgctaatg
ggctacgccaacccgatcgagcgcatgggcgccgacgcgttcgcggcggccgcgaaggat
gcgggcgtggacggggtgctcgtcgtcgactatccgccggaagaatctgccaacttcgcc
gaaacgatgaaggcagctggaatcgatccgatttttctgctggcgcccacgtcgacagac
gagcgcatcgcggaggttggtaaaatcgcgtccggttatgtctactatgtgtcgctgaag
ggcgtgacgggcgccgcgaatctggacgttttgagcatcgcgggtaaaatcccggcaatc
aagtcgcgcgtaccgctgccggtcggcgtcggtttcggcattcgcgacgcgcaatccgcg
cgcgccgtcgccgaagtgtccgatgccgtcgtgatcggcagccgtatcgtgcaattgctc
gaagaagcagcaccccagtccgctgccggcaaactgacgaacttcatcaaggagattcgc
caggcgctcgacagcatcggcgcgactgccggataa

DBGET integrated database retrieval system