KEGG   Burkholderia phymatum: Bphy_4391Help
Entry
Bphy_4391         CDS       T00704                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bph  Burkholderia phymatum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bphy_4391
Enzymes [BR:bph01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Bphy_4391
Exosome [BR:bph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bphy_4391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1425533..1427758)
Genome map
AA seq 741 aa AA seqDB search
MSEQHNVQLDAAGLNRVDLDALVDARHHDPFSQLGMHQTSAGPVVRVMLPNAAHVAVIAR
DDGRLLGELEQLHPGGLFAGPVSEAVPYRLRIDWHGSVQEIEDTYSFGSVLGDEPLQRVA
WGDPYAVLECLGSRPHTMDGVPGVRFAVWAPNARRVSVVGDFNSWDGRRHPMRLRHQAGV
WELFVPRIGAGTRYKYEMLARDGHPLPLKADPCAMQTEKPPATASIVAHVDEVEHFPWTD
GDWMQTRGGKQTAQSAISIYEVHAESWLRIAEEGHRGLNWSELADRLIPYAKEMGFTHIE
FMPVAEHPFGGSWGYQPLSQFAPSARFGTPEQFAGFVNRAHEAGLGVILDWVPAHFPNDS
HGLVEFDGTPLYEHADPREGYHQDWNTMIYNLGRNEVSAFLIASALAWLKRYHVDGLRVD
AVASMLYRDYSRAAGEWVPNIYGGRENLESIAFLKRLNHEVQHMPDVHGAITIAEESTAW
PGVTARVDDGGLGFQFKWNMGWMHDTLHYMHEDPIYRQWHHHNMTFAMVYAYSEKFVLPL
SHDEVVHGKGSLLGKMPGDRWQKFANLRAYFGFMWTHPGKKLMFMGGEFGQMAEFDHDGS
PHWHLLDDELHHGVQRLVRDLNRLYREEPALHRLDTEPGGFEWIIGDDTANSVFAWRRVD
GAGRELITVCNFTPVPRHGYRVGMPRPGRWVEVVNTDAAVYGGSNVGNGGVIYTDEVAAH
GRPQSAALVLPPLGTIVLRAD
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcaacacaacgttcaactagatgcggccggtctgaatcgcgtggacctggat
gcgctcgtcgatgcgcgccatcacgatccgttttcgcaactgggcatgcaccagacaagc
gccggtcccgtcgtccgcgtgatgctgccgaacgcagcgcacgtcgcggtgattgcgcgc
gacgacggccggctgctcggcgaactggaacagctgcatccgggcggcctgttcgcgggc
ccggttagcgaagccgtgccgtatcgcttgcggatcgactggcatggctcggtgcaggag
atcgaagacacctattcattcggctccgtgctcggcgacgagccgttgcagcgcgtcgcg
tggggcgatccctatgcggtgctcgaatgcctcgggtcgcggccccacacgatggacggc
gtgcctggcgtgcgcttcgcggtgtgggcgccgaatgcgcggcgcgtgtcggtcgtgggc
gacttcaactcgtgggacggccgccggcatccgatgcgtctgcgccaccaggcaggcgtg
tgggaactgtttgtgccgcgcatcggcgcgggcacgcgctacaagtacgagatgctggcg
cgcgacgggcatccactgccgctcaaggccgacccttgcgcgatgcagacggagaagccg
cccgcgacggcatccatcgtcgcgcatgtcgacgaggtcgagcatttcccgtggacggac
ggcgactggatgcagacgcgtgggggcaagcagacggcgcaatcggcgatttcgatttac
gaggtgcacgcggaatcgtggctgcgcatcgcggaggaagggcatcgcggcctgaactgg
tcggagctggcggatcgcctgattccgtacgcgaaggaaatgggcttcacgcatatcgag
ttcatgcccgtggccgagcatcccttcggcggctcgtggggttatcagccgctgtcgcag
ttcgcgccgtcggcacgcttcggcacgccggagcagttcgcgggcttcgtgaaccgcgcg
cacgaagcgggactcggcgtgattctcgactgggtgcctgcgcactttccgaacgattca
catgggctggtggagttcgacggcacgccgctttacgagcatgccgatccgcgcgagggc
tatcaccaggactggaacacgatgatttacaacctcggccgcaacgaggtgagcgcgttc
ctcatcgcgtcggcgctggcgtggctgaagcgctatcacgtcgacggcctgcgcgtcgat
gctgtcgcgtcgatgctctaccgcgactattcacgcgcggcgggcgagtgggtgccgaat
atttatggcggccgtgagaatctcgagtcgattgcgtttctgaagcgcctgaatcatgaa
gtgcagcatatgccagacgtgcacggcgcaatcacgatcgcggaggaatcgacggcatgg
ccgggcgtgacggcgcgcgtcgacgatggcggactgggctttcagttcaagtggaacatg
ggctggatgcacgacacgctgcactacatgcatgaagacccgatctatcggcaatggcat
caccacaacatgacgtttgcgatggtgtacgcgtattcggagaagttcgtgctgcctttg
tcacacgatgaagtcgtgcacggcaaaggctcgctgctgggcaagatgccgggcgaccgc
tggcaaaagtttgcgaatctgcgagcgtacttcgggttcatgtggacgcatccgggcaag
aagctgatgttcatgggcggcgagttcgggcagatggcggagttcgatcacgacggatcg
ccgcactggcatctgctcgacgacgagttgcaccacggggtgcaacgtctggtgcgcgat
ctgaaccggttgtatcgtgaggaaccggcgctgcatcgtctcgatactgagccgggcggg
ttcgagtggatcatcggcgatgacaccgctaattctgttttcgcctggcgtcgcgtggat
ggcgcggggcgtgaactcattacggtgtgcaacttcacgcccgtgccgcggcatggctat
cgggtcgggatgcctcgtccggggcgttgggtcgaagtcgtgaatacagatgccgcggtt
tacggcgggtctaacgttggcaacggcggtgtgatctatacggatgaggtggcggcgcat
gggcggccgcagtccgctgctctggtgttgccaccattggggacgattgtgctcagggcc
gattga

DBGET integrated database retrieval system