KEGG   Burkholderia phymatum: Bphy_4454Help
Entry
Bphy_4454         CDS       T00704                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bph  Burkholderia phymatum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bphy_4454
Enzymes [BR:bph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Bphy_4454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1494857..1495486)
Genome map
AA seq 209 aa AA seqDB search
MTTKKTIPTDAPGRPSREEAEEAVRTLLRWAGDNPQREGLLDTPARVVRAYEEFFAGYNV
EPRDILARTFSEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPEHRVVGISKLAR
LVDAFAKRLQIQEKMTVQIADTLNEVLQPKGVGVILEASHQCMSTRGVHKAGVEMVTSRM
LGTFRSDPSTRREFLSIVNSPTSVSVANT
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaagaaaacaatacccaccgacgcacccggccggccgtcccgcgaggaagcc
gaagaagccgtgcgcacgttgctgcgctgggcgggcgacaatcctcagcgcgaggggctg
ctcgacacgccggcgcgcgtcgtgcgggcgtatgaagaatttttcgcgggctacaacgtg
gagccgcgcgatatcctggcgcgcacgttttcggaagtggacggttacgatgagatgatt
gtgctcaaggacattcgtttcgagagctattgcgagcatcacatggtgccgatcattggg
cgcgcgcacgttgcttatttgcctgagcatcgggtggtgggaatttccaagctggcgcgc
cttgtcgatgcgtttgccaagcggctgcagattcaggagaagatgacggtgcagatcgcc
gataccctgaacgaagtattgcagccgaagggtgtcggtgtgattctcgaggcttcgcat
cagtgtatgtcgacacggggcgtgcacaaggctggcgtcgagatggtgacgtcccggatg
ctcgggactttcagatcggatccttcgacccggagggaattcttgtcgatcgtgaatagt
cctacatcggttagtgtggctaatacctag

DBGET integrated database retrieval system