KEGG   Paraburkholderia phymatum: Bphy_4454Help
Entry
Bphy_4454         CDS       T00704                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bph  Paraburkholderia phymatum
Pathway
bph00790  Folate biosynthesis
bph01100  Metabolic pathways
Module
bph_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bphy_4454
Enzymes [BR:bph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Bphy_4454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF PPV_E2_C
Motif
Other DBs
NCBI-ProteinID: ACC73568
JGI: Bphy4454
UniProt: B2JQM7
Position
2:complement(1494857..1495486)
Genome map
AA seq 209 aa AA seqDB search
MTTKKTIPTDAPGRPSREEAEEAVRTLLRWAGDNPQREGLLDTPARVVRAYEEFFAGYNV
EPRDILARTFSEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPEHRVVGISKLAR
LVDAFAKRLQIQEKMTVQIADTLNEVLQPKGVGVILEASHQCMSTRGVHKAGVEMVTSRM
LGTFRSDPSTRREFLSIVNSPTSVSVANT
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaagaaaacaatacccaccgacgcacccggccggccgtcccgcgaggaagcc
gaagaagccgtgcgcacgttgctgcgctgggcgggcgacaatcctcagcgcgaggggctg
ctcgacacgccggcgcgcgtcgtgcgggcgtatgaagaatttttcgcgggctacaacgtg
gagccgcgcgatatcctggcgcgcacgttttcggaagtggacggttacgatgagatgatt
gtgctcaaggacattcgtttcgagagctattgcgagcatcacatggtgccgatcattggg
cgcgcgcacgttgcttatttgcctgagcatcgggtggtgggaatttccaagctggcgcgc
cttgtcgatgcgtttgccaagcggctgcagattcaggagaagatgacggtgcagatcgcc
gataccctgaacgaagtattgcagccgaagggtgtcggtgtgattctcgaggcttcgcat
cagtgtatgtcgacacggggcgtgcacaaggctggcgtcgagatggtgacgtcccggatg
ctcgggactttcagatcggatccttcgacccggagggaattcttgtcgatcgtgaatagt
cctacatcggttagtgtggctaatacctag

DBGET integrated database retrieval system