KEGG   Burkholderia phymatum: Bphy_4693Help
Entry
Bphy_4693         CDS       T00704                                 

Definition
(RefSeq) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bph  Burkholderia phymatum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bphy_4693
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bphy_4693
   00640 Propanoate metabolism
    Bphy_4693
   00660 C5-Branched dibasic acid metabolism
    Bphy_4693
Enzymes [BR:bph01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bphy_4693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1758492..1759715)
Genome map
AA seq 407 aa AA seqDB search
MNIHEYQAKALLKGYGVAVPNGRVAFTPREAEDAALALGGAVWVVKSQIHAGGRGAGRFA
DDPNGKGGVRVVKSVSDVGSSAEQMLAHVLVTKQTGPAGREVKRVYVEEGCAIERELYLG
MLIDRSTSRITVMASTEGGMEIEEVAAHTPEKILKVAIDPATGLQPFHARQLAFGLGLTG
KQVKSATQFIANAYRAFVELDASIVEINPLVVTQQGDVIALDAKINFDDNALFRHPAIEA
LRDEAEEDAAELEAAKHGLNYVTLDGNIGCMVNGAGLAMATMDIIKLYGGEPANFLDVGG
GATRERVATAFRLILRDPKVEGILVNIFGGIMRCDVIADGVVSAAREVDLRVPLVVRLEG
TNVELGKQILRDSGLPILSADHLADAASKVVAAVKDKNHAVAATEAN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatccacgaatatcaggcgaaggcactgttgaaaggctacggcgtcgccgtgccg
aacgggcgcgtcgcgttcacgccgcgggaggccgaagacgcggcgctcgcgctgggcggc
gcggtgtgggtcgtcaagtcgcagattcatgcgggtgggcgcggtgcaggccgcttcgcc
gacgatccgaacggcaagggcggcgtgcgcgtcgttaagtcggtcagcgacgtcggttcg
agcgccgagcaaatgctggcgcacgtgctcgtcacgaagcagaccgggccagcgggccgc
gaagtgaagcgcgtctatgtagaggaaggctgcgcgatcgaacgtgagctgtatctcggc
atgctgatcgaccgcagcacctcgcgcattaccgtgatggcgtcgacggaaggcggtatg
gaaatcgaggaagtggccgcgcatacgcccgagaagatcctcaaagtcgctatcgatccc
gcaaccggcctgcagccgttccacgcgcgccagctcgccttcggactcgggctgacgggc
aagcaggtcaagtcggcgacgcagttcatcgccaacgcgtatcgcgcgttcgtcgaactg
gacgcgtcgatcgtcgagatcaaccccctcgtcgtcacgcagcaaggcgacgtgatcgcg
cttgacgcgaagatcaatttcgacgacaacgccctgttccgccaccccgccatcgaagcg
ctgcgcgacgaagccgaagaagacgccgccgaactcgaagccgccaaacatgggctgaac
tacgtcacgctcgacggcaacatcggctgcatggtgaacggtgcgggcctcgccatggcg
acgatggacattatcaagctctatggcggcgagccagccaactttctcgacgtgggcgga
ggcgcgaccagggagcgcgtcgcgacggcattccgtctgattctgcgcgatccaaaagtg
gaagggattctggtcaacatcttcggcggcatcatgcgctgcgacgtgatcgcggacggc
gtggtgagcgccgctcgcgaagtggatctgcgggtgccgctcgtggtgcggctcgaaggc
accaacgtcgaactcggcaagcagattctgcgcgactcgggcctgcccattctgtcagcc
gatcatctcgccgacgcagcgagcaaggtggtcgccgcagtcaaggacaagaaccacgcg
gtagccgcgacggaggcaaactga

DBGET integrated database retrieval system