KEGG   Burkholderia phymatum: Bphy_4746Help
Entry
Bphy_4746         CDS       T00704                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bph  Burkholderia phymatum
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bph00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:bph00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1813878..1815389
Genome map
AA seq 503 aa AA seqDB search
MSYRINRRAFLGGAASVITWATLPFYARAATTTNLIRVEWQTFKTTPHYAPFLNAVRTMQ
ANTNAADPNSWQYWTNVHANYCPHKQPYFLAWHRGYLYYLERQIRLVSGDAGFTLPYWDW
FTNPHVPAEFTDQASGNPLYCPRLNTNVYNALDLSPWASTTVNFQRGTVNSFEEKFETAP
HNPVHNIIGNSMATMQSPRDPIFYLHHANVDRLWHAWALPDGRTMPVPSDPYWSGLFTYA
TGLTILKEQTYSARTRLGYDYDNASRPTTMPPQAQVGRIIRVQASIGPSHTRPPAGSFTA
TAARNIDTGVRSIGGVKAVTLREQSTTARITGEAASTAPVQQLLSATAAPYAAAERGDRS
SAASVNGAAAGQYRSIRVVFDEISLTQAGAAGGYYYNVYLNLPDRFDTDTARQQNLLGTF
GAFEIAGASHHGMVMLEYPATASLLKTGNGASRDYYVTLERVNGPNAPRGAVINVGEIRV
ELSTEPAYIVSPARSRAPTDVPY
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtatcgaatcaatcggagagcgtttctgggcggggctgcgtcggtcattacgtgg
gctaccttgcccttttacgcacgggctgccaccacgactaacctgatccgcgtcgaatgg
cagacatttaaaacgacaccgcattacgcgccgtttcttaatgccgttcgaaccatgcag
gcaaatacgaacgcggcggacccgaattcctggcaatactggaccaacgttcacgcaaat
tattgtccgcacaagcagccgtattttctcgcgtggcatcgcggttatctgtattacctc
gaacgccagataaggctcgtttcgggcgacgcgggcttcacgctgccatactgggactgg
ttcacgaatccacatgtgcccgcggaattcacggatcaggcgagcggcaatccgctttac
tgtccgcgcctgaacaccaatgtgtataacgcgctcgatctttcaccgtgggcgtcgacg
acagtgaatttccagcgtggcaccgtcaactctttcgaagagaagttcgagacggcgccg
cacaaccccgtgcacaacatcatcggcaattcgatggccacgatgcagtcgcctcgcgat
ccgatcttttatctgcatcacgcgaacgtcgaccgtctgtggcatgcatgggcgctgccc
gacggtcgcacgatgccagtgccgagcgatccgtactggtcgggtctgttcacttacgcg
acgggcctgacgatcctcaaagagcagacctactcggcacggacgcgtctcggttacgac
tacgacaatgcgtcgcgtccgacgacgatgcctccgcaagcccaggtggggcgcatcatt
cgcgtccaggcgagcatcggcccgtcgcatactcgtccgccagccggctcgttcaccgca
acggccgcgcgcaatatcgacacaggtgtgcgttcgatcggcggcgtgaaagccgtcacg
ctgcgcgaacaatcgacgactgcgcgtatcacgggcgaggccgcatcgacggcgcctgtt
cagcaactgctgtccgccacagctgcgccgtacgccgctgcggagcgcggcgatcgctcg
tcggcagcctctgtcaacggagcggcagcggggcaataccgttcgattcgcgtcgtattc
gacgagatctccttgacgcaagcgggcgcggcaggcggctactactacaacgtgtatctg
aatctgcccgacaggttcgacaccgatacggcgcgccagcaaaacctgctgggcacgttt
ggcgcgtttgagatcgccggcgcgtcccatcacggcatggtcatgctcgagtatcccgcg
acggcttcgttgctgaaaacgggcaacggcgcatcgcgcgactactatgtgacgctcgaa
cgggtcaacgggccgaatgcaccccgaggtgccgtcatcaacgtcggcgagattcgggtc
gaactgtccactgagccggcgtacatcgtgtctcccgcacgcagccgcgcgccgacggac
gtcccgtattga

DBGET integrated database retrieval system