KEGG   Burkholderia phymatum: Bphy_4746Help
Entry
Bphy_4746         CDS       T00704                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bph  Burkholderia phymatum
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bphy_4746
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Bphy_4746
Enzymes [BR:bph01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Bphy_4746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1813878..1815389
Genome map
AA seq 503 aa AA seqDB search
MSYRINRRAFLGGAASVITWATLPFYARAATTTNLIRVEWQTFKTTPHYAPFLNAVRTMQ
ANTNAADPNSWQYWTNVHANYCPHKQPYFLAWHRGYLYYLERQIRLVSGDAGFTLPYWDW
FTNPHVPAEFTDQASGNPLYCPRLNTNVYNALDLSPWASTTVNFQRGTVNSFEEKFETAP
HNPVHNIIGNSMATMQSPRDPIFYLHHANVDRLWHAWALPDGRTMPVPSDPYWSGLFTYA
TGLTILKEQTYSARTRLGYDYDNASRPTTMPPQAQVGRIIRVQASIGPSHTRPPAGSFTA
TAARNIDTGVRSIGGVKAVTLREQSTTARITGEAASTAPVQQLLSATAAPYAAAERGDRS
SAASVNGAAAGQYRSIRVVFDEISLTQAGAAGGYYYNVYLNLPDRFDTDTARQQNLLGTF
GAFEIAGASHHGMVMLEYPATASLLKTGNGASRDYYVTLERVNGPNAPRGAVINVGEIRV
ELSTEPAYIVSPARSRAPTDVPY
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtatcgaatcaatcggagagcgtttctgggcggggctgcgtcggtcattacgtgg
gctaccttgcccttttacgcacgggctgccaccacgactaacctgatccgcgtcgaatgg
cagacatttaaaacgacaccgcattacgcgccgtttcttaatgccgttcgaaccatgcag
gcaaatacgaacgcggcggacccgaattcctggcaatactggaccaacgttcacgcaaat
tattgtccgcacaagcagccgtattttctcgcgtggcatcgcggttatctgtattacctc
gaacgccagataaggctcgtttcgggcgacgcgggcttcacgctgccatactgggactgg
ttcacgaatccacatgtgcccgcggaattcacggatcaggcgagcggcaatccgctttac
tgtccgcgcctgaacaccaatgtgtataacgcgctcgatctttcaccgtgggcgtcgacg
acagtgaatttccagcgtggcaccgtcaactctttcgaagagaagttcgagacggcgccg
cacaaccccgtgcacaacatcatcggcaattcgatggccacgatgcagtcgcctcgcgat
ccgatcttttatctgcatcacgcgaacgtcgaccgtctgtggcatgcatgggcgctgccc
gacggtcgcacgatgccagtgccgagcgatccgtactggtcgggtctgttcacttacgcg
acgggcctgacgatcctcaaagagcagacctactcggcacggacgcgtctcggttacgac
tacgacaatgcgtcgcgtccgacgacgatgcctccgcaagcccaggtggggcgcatcatt
cgcgtccaggcgagcatcggcccgtcgcatactcgtccgccagccggctcgttcaccgca
acggccgcgcgcaatatcgacacaggtgtgcgttcgatcggcggcgtgaaagccgtcacg
ctgcgcgaacaatcgacgactgcgcgtatcacgggcgaggccgcatcgacggcgcctgtt
cagcaactgctgtccgccacagctgcgccgtacgccgctgcggagcgcggcgatcgctcg
tcggcagcctctgtcaacggagcggcagcggggcaataccgttcgattcgcgtcgtattc
gacgagatctccttgacgcaagcgggcgcggcaggcggctactactacaacgtgtatctg
aatctgcccgacaggttcgacaccgatacggcgcgccagcaaaacctgctgggcacgttt
ggcgcgtttgagatcgccggcgcgtcccatcacggcatggtcatgctcgagtatcccgcg
acggcttcgttgctgaaaacgggcaacggcgcatcgcgcgactactatgtgacgctcgaa
cgggtcaacgggccgaatgcaccccgaggtgccgtcatcaacgtcggcgagattcgggtc
gaactgtccactgagccggcgtacatcgtgtctcccgcacgcagccgcgcgccgacggac
gtcccgtattga

DBGET integrated database retrieval system