KEGG   Paraburkholderia phymatum: Bphy_5113Help
Entry
Bphy_5113         CDS       T00704                                 

Definition
(GenBank) glucose-methanol-choline oxidoreductase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
bph  Paraburkholderia phymatum
Pathway
bph01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Bphy_5113
Enzymes [BR:bph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Bphy_5113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_N GMC_oxred_C Pyr_redox_2 Abhydrolase_1 Abhydrolase_6 DAO FAD_binding_2 FAD_oxidored NAD_binding_8 GIDA Fer4_6 Fer4_7 Pyr_redox HI0933_like Fer4_2
Motif
Other DBs
NCBI-ProteinID: ACC74200
JGI: Bphy5113
UniProt: B2JLX2
Position
2:complement(2215530..2218928)
Genome map
AA seq 1132 aa AA seqDB search
MNRLSSALSAMKDHYEVVVVGSGYGGAIAASRMARAKRSVCLLERGREFMAGDFPATQLE
GVAQVQYNTSVAQIGSPLALLEVHVNPDANVVVGCGLGGTSLINANVALKPDARLWDDPR
WPAAVRADQANLELCYARATTMLGATPVPDDYPDLPKLDALELSAKRLDMSNRFYRPPIT
VTFKDGKNAAGVDQKRCNGCGDCNSGCNHGAKNSTHMNYLPDAVAHGAQIFTGAAVHSVV
RDEKRGVWCVRYQPADLKRELYDAPEMFVTADIVILSAGTLGSTAILLRSAQAGLSVSTQ
LGKHFTGNGDVLAFAFNTDKVINGVGWGTHPAGDIPPVGPCIAGIIDHRDTPNVKDGFVI
EEGSIASPIGLGLMGVLGVAAPAEGVEMPDPEGEPLLADEARIAESILRGPHHGAMRNTQ
TWLVMAHDDESGQITVEDGRPRVSWPNAGKQPIYETVEKTLIEATSALGGSYVRNPISSD
MFQNRTVTVHPLGGCGMADDAAHGVVDQAGRVFSGVQGNAVHEGLYVMDGAVMPLSLGVN
PLLTISALAERNCEQLAQSRGWQIDYDSAGNTAPPPAPKIGLRFTETMIGTFYAGDVKPE
GQQDNRAEGTPISFTVTVVSDDLDDMLANRQHQAHMIGTLTCTALSPQPMTVNDGIFNLF
VVDETNVDRRNMNYRMTLDTVDGKHFYLTGQKIITHTSLTELWTQTNTLYAKVRESAADD
APVIGHATLVITPENFLKQQRTIEVTNAPDVETRLAYTLKFGRFFAGVLYTEYGGVAAPL
QYFDPDAPPRMRRTLRAPAPQITYFDTEDGKTLRLARYHGGDKGPLLLIHGSGVSSRIFS
TDLIGTNLVEFLCAAHYDVWLVDLRVSIELPSATERTTADDIARYDIPAAVAKVRELTGA
DQIQVFGHCLGALAFSMSLMSGLKGVRSAVLSQVSAHPVPGLLQRIKAGLHTPQILQHLG
VKDMTAYTRHEKWPHNLLDEALKFFPVGHDESCDSPVCHRATFLYGLLYEHAQLDERLHA
NLQELFGIHDVELFNQLAAMVRAGHVVDANGDDVYLPNLDGMKLPIAFIHGTENLCYLPT
STEMTYDLLVERFGPDNYERHLIEGYGHIDCVFGKRAALDVFPTIVRHLDAH
NT seq 3399 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcttgtccagcgccctttcggcgatgaaggaccattacgaggtggtggtggtg
ggttccggctatggcggcgcgattgccgcaagccgcatggcacgtgcgaaacgcagcgtg
tgcctgcttgagcgcgggcgcgagttcatggcgggcgattttcccgccacacaactcgaa
ggtgtcgcgcaggtgcagtacaacacgagcgtcgcccagatcggctcgccgctcgcgctg
ctcgaagtgcatgtgaacccggatgcaaacgtcgtggtcggctgcggactcggcggcacc
tcgctgatcaacgcgaacgtcgctctcaagcccgacgcacgcctttgggacgacccgcgc
tggcccgccgccgtgcgcgcggaccaggcgaatctggagctgtgctacgcgcgagcaacg
acaatgctcggcgcgacgcccgtccccgacgactatcccgatctgccgaaactcgacgct
ctggagttgtccgcgaaacggctcgatatgagcaaccgtttctaccgtccgcccatcacc
gtgacgttcaaggacggcaagaacgcggcgggtgtcgaccagaagcgctgcaacggctgc
ggcgactgcaactcgggctgcaatcacggcgcgaagaactcgacgcacatgaactatctg
cccgacgccgtcgcgcacggcgcgcagattttcacgggcgcggccgtgcattcggtggtg
cgcgacgagaagcgaggggtctggtgcgtgcgctatcagcctgccgatctcaagcgcgaa
ctgtacgacgcaccggaaatgttcgtgacagccgatatcgtgattctttccgcgggcacg
ctgggctcgaccgcgatcctgctgcgttcggctcaggccggcctatccgtgtcgacgcag
ctcggcaagcacttcacgggcaacggcgacgtgctcgcgttcgcgttcaacaccgataag
gtgatcaacggcgtcggctggggtacgcatcccgcaggcgacattccgcccgtcggcccg
tgcatcgcgggcatcatcgaccatcgcgacacgccgaacgtgaaggacggcttcgtgatc
gaagaaggctcgatcgcgtcaccaatcggcctcggcctgatgggcgtgctcggcgtcgcg
gcgcccgccgaaggcgtcgagatgccggatccggaaggcgagccgctgctcgcggacgaa
gcgcgtatcgccgagagcatcctgcgcggcccgcatcacggcgcgatgcgcaacacgcag
acatggctggtgatggcgcacgacgacgaaagcggccagatcaccgtcgaagatggccgg
ccgcgcgtgagctggccgaacgcgggcaagcagccgatctacgagaccgtcgaaaagacg
ctgatcgaagccaccagcgcgctgggcggctcgtacgtgcgcaatccgatctcgagcgac
atgtttcagaaccgcaccgtcaccgtgcatccgctgggcggctgcgggatggcggacgat
gcggcgcatggcgtcgtcgatcaggcgggccgtgtgttttccggcgtgcagggcaacgcg
gtgcacgaggggttgtacgtgatggacggggcggtgatgccgctctcgctcggcgtgaac
cctctgctgaccatttcggccctcgccgagcgcaattgtgagcaacttgcgcagtcgcgc
ggctggcagatcgactatgactccgcaggcaacacggcgccgccgccggcgccgaagatc
ggcctgcgcttcaccgagacgatgatcggcacgttttacgcaggtgacgtcaaaccggaa
ggccagcaggacaaccgcgctgaaggcacgcccatcagcttcaccgtgaccgtcgtatcc
gacgatctcgacgacatgctcgcgaaccgccagcatcaggcgcatatgatcggcacgctg
acctgcaccgcgctgtcgccccagcccatgaccgtaaacgacggcatcttcaacctgttc
gtcgtcgatgaaacgaatgtcgaccggcgcaacatgaactaccggatgacgctcgatacc
gtcgacggcaagcatttctatctgaccggtcagaagatcatcacgcatacgtcgctgacg
gaattatggacgcaaaccaatacgctctacgcaaaggtgcgcgagtccgctgccgatgac
gcgccggtaatcggccacgcgacactcgtcatcacgccggagaactttctcaagcagcag
cgcacgattgaagtgacgaacgcgcccgacgtcgaaacgcgcctcgcctacacgctgaaa
ttcggccgtttctttgcaggcgtgctttacacggaatacggcggcgtcgccgcgccattg
cagtacttcgaccccgatgccccgccgcgcatgcgccgcacgttgcgcgcgcccgcgccg
cagatcacctacttcgataccgaggacggcaagacgctgcggcttgcgcgctatcacggc
ggcgacaaagggccgttgctgctcattcacggttcgggcgtatcgagccgcatcttttcg
accgacctgatcggcacgaatctcgtcgagttcctgtgcgccgcgcattacgacgtgtgg
cttgtcgatctgcgcgtgagcatcgaactgccgagcgccactgaacgcactacggccgac
gacatcgcgcgctacgacatacccgctgccgtcgccaaggtgcgcgagttgacgggcgcc
gatcagatccaggtattcggccattgcctgggcgcgctggcgttcagcatgtcgctgatg
tcggggctgaagggcgtgcgttccgccgtactgtcgcaagtctccgcgcatcctgtgccg
ggactgttgcagcggatcaaggcggggctgcacacaccgcagatcctccagcatcttgga
gtcaaggacatgaccgcttacacgcggcacgaaaagtggccgcacaatctgctcgacgaa
gcactgaagttcttccccgtcgggcacgacgaatcctgcgacagcccggtgtgccatcgc
gcgacgttcctgtatgggctgctgtatgagcacgcgcagctcgacgaaaggctgcatgcg
aatctgcaggagctattcggtattcacgatgtcgagctgttcaaccagctcgctgcgatg
gtgcgcgcggggcatgtcgtggacgcgaatggcgacgatgtctatctgcctaacctcgac
ggcatgaagctgccgatcgcgtttattcacgggacggaaaatctctgctatctgcccacc
agcacggagatgacgtacgacctgctcgtcgagcgtttcgggcccgacaactatgagcgg
catctgatcgaaggctatggacacatcgattgcgtgttcgggaaacgcgcggcgctcgat
gtgtttccgaccatcgtcaggcatctggatgcgcactga

DBGET integrated database retrieval system