KEGG   Burkholderia phymatum: Bphy_5127Help
Entry
Bphy_5127         CDS       T00704                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bph  Burkholderia phymatum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bph01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bph00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bph00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bph00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bph00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2235197..2236903
Genome map
AA seq 568 aa AA seqDB search
MTAAQGFFDARDLLLRHRTDYERAYAEFKWPKLDEFNWALDYFDVVAQGNHNPALWIVDD
PAQQGLKLSYAQMAERSSQMANFLRRLGVARGDRLLLMLPNRVELWDVMLAAMKLGAIVL
PATTQLSPDDVRDRVQIGGANVVVVDSVETAKFDGLDAALKRISVGAPRDGWTDIAGAYE
SSPAFTPDGITRASDPMLLYFTSGTTSKPKLVEHTHQSYPVGHLSTMYWIGLQPDDIHWN
ISSPGWAKHAWSCFFAPWNAQACVFVFNFARFVPKETLDVLVRCNVTTLCAPPTVWRMLV
QEPLASYPVKLREIVGAGEPLNPEIIERVRHAWNITIRDGYGQTETTCQIGNPPGQPVVP
GSMGRPLPGYRVELVDADDHPVTEGEIALPLDARPLGLMTGYANNAKATEHAMRNGYYHT
SDVAMRRDDGYLVYVGRSDDVFKSSDYRLSPFELESVLIEHEAIAEAAVVPSNDPLRLSV
PKAFVTVRHGFEAGPELARDVFRFSREKLAPYKRIRRLQFSDLPKTISGKIRRVELRRRE
LERTAEPARLPDEYWEEDFPELRNGNGN
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgacggcagcccaaggctttttcgacgcgcgcgatctgctcttgcgccatcgcacggac
tacgagcgcgcgtacgcagagttcaaatggccaaaactcgatgagttcaactgggcgctc
gattatttcgacgtcgttgctcaaggcaaccacaaccctgccctttggatcgtcgacgac
cccgcacagcaaggactgaaactctcgtatgcgcagatggccgagcgctcgtcgcagatg
gcaaattttctgcgcagactcggcgtcgcgcgcggcgaccgccttctgctcatgctgccc
aatcgcgtcgaactgtgggacgtgatgctcgcggcaatgaagctcggcgccatcgtgctg
cccgccaccacgcaactgtcgcccgacgatgtgcgcgaccgcgtccagatcggcggtgca
aatgtcgtcgtggtcgatagcgtggagaccgccaagttcgatggactcgatgccgcgctg
aaacgcatctcggtcggcgcgccgcgcgacggctggaccgacatcgccggcgcatacgag
tcatcgccggcgttcacgcccgatggcatcacgcgcgcctccgatccgatgctgctgtac
ttcacgtcgggcacgacgtcgaagccgaagctcgtcgagcacacgcatcagagctatccc
gtcggccatctgtcgaccatgtactggatcggcctgcaacccgacgacatccactggaac
atcagctcgcccggctgggccaagcacgcgtggagctgtttcttcgcgccgtggaacgcg
caggcgtgcgtgttcgtcttcaacttcgcgcgcttcgtgccgaaggaaacgctcgacgtg
ctggtgcgctgcaacgtcacgacgctctgcgcgccacccaccgtgtggcgcatgctcgtg
caggagccgctcgcgtcgtaccccgtcaagctgcgcgagatcgtcggcgcgggcgagccg
ttgaatccggagatcatcgagcgcgtgcggcatgcatggaacatcacgatccgcgacggc
tacgggcagacggaaaccacctgccagataggcaatccgccggggcagccggtcgtgccc
ggatcaatggggcgtccgctgccgggctatcgcgtcgaactcgtcgatgccgacgatcat
cccgtgacggaaggcgaaatcgcgttgccgctcgacgcgcgcccgctcggcctgatgacg
ggctacgcgaacaacgcgaaggccaccgaacacgcgatgcgcaacggctactaccacacg
tccgatgtcgcgatgcggcgcgacgacggctatctcgtctatgtgggacgctcggatgac
gtgttcaagtcgtccgattaccggttgagtccgttcgaactcgaaagcgtgctgatcgag
cacgaagcaattgccgaggcggccgtcgtgccgagcaacgatccgctgcgcctgtcggtg
ccgaaggccttcgtcaccgtgcgacatggtttcgaagccggcccggaactcgcgcgcgac
gtgttccgcttttcgcgcgaaaagctcgcaccctacaagcgcattcgacgccttcagttc
agcgatctgcccaagacgatctcaggcaagatccgccgcgtcgaactgaggcggcgggaa
ctggagcgcacggccgagcccgcgcgtttgcccgacgagtactgggaagaggacttcccc
gagcttcgcaacggcaacggcaactga

DBGET integrated database retrieval system