KEGG   Burkholderia phymatum: Bphy_5497Help
Entry
Bphy_5497         CDS       T00704                                 

Definition
putative phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
bph  Burkholderia phymatum
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bphy_5497
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bphy_5497
Enzymes [BR:bph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Bphy_5497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2647064..2649448)
Genome map
AA seq 794 aa AA seqDB search
MDDTRLQPTPLQADELRNMDGYWRACNYLAAGMIYLRENPLLREPLQAGHIKRRLLGHWG
SDPGQSFVLVHLNRVIKQRDLNVIFLSGPGHGAPASLAHSYLEGRYSEIYPDRGESEEGM
ARLFKLFSFPGGIGSHCTPETPGSIHEGGELGYSLSHGYGAAFDNPDLIVTVMIGDGEAE
TGPLATAWHSNKFLNPARDGAVLPVLHLNGYKIANPTILARIPHEELEALFNGYGYKPWF
VEGDDPDTMHQQMAATLDQCLDEIHAIQQRARQGGDLQRPRWPMIVLRTPKGWTGPREFG
GHRIEGSWRAHQVPIADPASNEQSLKRVEEWLRSYRPEELFDESGRLVRELRALAPEGPR
RISANPHANGGALCKALDLPAFADYAVDVVTPATRYLSPTDVLGQFLCDVMRRNMTSFRV
FGPDETSSNKLTAIYEASQKTWLAEVVESDGDGGYLSADGRVMEMLSEHTLEGWLEGYTL
TGRHGLFATYEAFVHVIDSMFNQHAKWLEKAKRELRWRQPVPSLNLLITSLVWRQDHNGF
THQDPGFLDVVTNKSPDVVRIYLPPDANCLLSVADHCLRSRDYVNVIVADKQPHLQYLDM
PSAITHCTKGIGIWDWASTDQDHEPDVVMASAGDIPTMEALAAVEILKALFPDLKIRFVN
VVDLFRLMPAADHPHGLSTRDFDSLFTTDKPVIFNFHSYASLVHKLTYRRTNHENIHVHG
YAEKGNINTPLELAIINGIDRFSLAIDVIDRVPSLRGVGDHAKERLRDKRIEHLHYAHTE
GIDSEEIREWTWKG
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggacgacacccgcctgcaacccacgccgttgcaagccgatgaactgcgcaacatggac
ggctactggcgggcctgcaattacctggccgccggcatgatttacctgcgcgagaatccg
ctgctgcgcgagccgctgcaggccggacatatcaagcggcgcctgctgggacactggggc
tccgatccgggacaaagcttcgtgctcgtgcatctgaaccgggtcatcaagcagcgcgac
ctgaacgtgattttcctctcggggccgggccacggggcgcccgcctcgcttgcgcacagc
tatctggaaggacgctattcggagatctaccccgatcggggcgagtcggaagagggcatg
gcgcgtctgttcaagctcttttcgtttcctggcggcatcggctcgcattgcacacccgag
acgcccggctcgattcatgaaggcggcgaactgggctacagtctgtcgcatggttatggc
gcggcattcgacaaccccgatcttatcgtcaccgtgatgatcggcgatggcgaggccgag
acggggccgctggccacagcgtggcactcgaacaaattcctgaatccggcgcgcgacggc
gccgtgttgcccgtgctgcatttgaacggctacaagatcgcgaatccgacgatcctcgcc
cgcattccgcatgaagagctggaagcactgttcaatggttatggctacaagccttggttc
gtcgaaggcgacgatcccgacacgatgcatcagcagatggcggccacgctcgatcaatgc
ctcgacgaaattcatgcgatccagcaacgcgcgcgtcaaggaggcgatctgcaacggccg
cgctggccgatgatcgttctcagaacgccgaagggctggacagggccgcgcgaattcggc
ggacacaggattgaaggctcgtggcgcgcgcatcaggtgcctatcgccgatcccgcgagc
aacgagcagagcctcaagcgggtcgaggaatggttgcgcagctatcgcccggaagaacta
ttcgacgaatcagggcggctggtccgggagttgcgtgcgctcgcacccgaaggaccgcgc
cgcatcagcgccaatccgcacgcgaatggcggggcgctgtgcaaggcgctcgatctgccg
gcctttgccgactatgcggtcgacgtcgtcacgcccgccacacgctatctgtcgcctacc
gatgtgctcgggcagtttctttgcgacgtgatgcgtcggaacatgacaagctttcgcgtg
ttcggtccggacgaaacgtccagcaacaagctcacggcgatttacgaagcttcgcagaag
acgtggctcgcggaggtcgtcgaatcggacggcgacggcggttacctctctgccgatggc
cgcgtgatggaaatgctcagcgagcacacactggaaggctggctggaaggctatacgctg
acgggccggcatggcctgttcgccacgtacgaagcgttcgtgcatgtgatcgattcgatg
ttcaaccagcacgccaaatggctcgaaaaggcgaagcgcgaattgcgctggcgccagccc
gtgccttcgctgaatctgctgattacgtcgctggtgtggcggcaggatcataacggcttc
acgcatcaggacccgggctttctcgacgtcgtgacgaacaagagccccgacgtggtgcgc
atctatctgccgcccgacgcgaactgcctgttgagcgtcgccgatcattgcctgcgttcg
cgcgattacgtgaacgtgatcgtcgccgacaagcagcctcatttgcagtatctggacatg
ccgtcggccatcacgcattgcacgaaaggcatcggcatctgggactgggcgtcgacggat
caggaccacgagcccgacgtcgtgatggcgagcgcaggcgacatcccgaccatggaagcg
ctggctgccgtcgaaatcctcaaggcgctgttccccgacctgaagatccgcttcgtgaac
gtggtcgatctgttccggctaatgccggccgccgatcatccgcatggcctgtcgacgcgc
gatttcgattcgctcttcacgacagacaagcccgtgatcttcaacttccattcgtacgct
tcgcttgtccacaagctcacgtatcgccgcacgaatcacgagaacatacacgtgcacggc
tacgcggagaagggcaacatcaatacgccgctcgagcttgcgatcatcaacggcatcgac
cgcttctcgctcgcaatcgacgtgatcgatcgcgtgccgtcgctacggggcgtcggcgat
cacgcgaaggaacgcctgcgcgacaagcggatcgagcacctccactacgcgcacacggag
ggcattgactccgaagagattcgcgagtggacgtggaagggctag

DBGET integrated database retrieval system