KEGG   Burkholderia phymatum: Bphy_5564Help
Entry
Bphy_5564         CDS       T00704                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bph  Burkholderia phymatum
Brite
Enzymes [BR:bph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Bphy_5564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pBPHY01:28755..29645
Genome map
AA seq 296 aa AA seqDB search
MKTSVRTIFNEGDGHAVLMLHGLSSSPLELRYLARFLSDEGFTTCVPVLEGYTAGSREQS
MEQWLEAATREYDALAERYERVSICGLSIGAALALALVHRRPRAQSVALLSLTLAYDGWA
IPWYRFLLNWAYYSPLRSRYRYRESAPYGLRNDALRAKIARAMERDDFSEVGPSTISLPA
LHEASRLAACVRSQLRGIRNDCLIVHAIDDETSSPRNPRFVASSIGSAFLRTIWLDDSYH
MITSDNEREIVARETALFLRESEIASRTGDAGGKPVVSKALARRLRQLAAMGKGRA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctcggtccgaacgatcttcaacgaaggcgatggccacgccgttctgatgctg
catggtctttccagctcgccgctagaattgcgctatctcgcacgctttctgagcgacgaa
ggctttaccacgtgtgtgcccgtgctcgaaggctatacggccggctcgcgggaacagtcg
atggagcaatggctcgaggcggcgacgcgggaatacgacgcgctggccgagcgatacgaa
cgcgtgtcgatctgcgggctgtcgatcggtgcggcgctcgcactcgcgctcgtgcatcgc
cgcccccgggctcagtccgtcgcgctcctgtcgctgacgctcgcctacgatggctgggcg
atcccgtggtatcgctttctgctgaactgggcgtactactcgccgctgcgttcgcgctac
cgctatcgggagtcggcgccttatggactgcgcaacgatgcgctgcgcgccaagattgcg
cgcgcgatggagcgcgacgatttcagtgaagtcggcccgtcgaccatttcgctgcccgcc
ttgcacgaggccagccgacttgcggcctgcgtgcgttctcagttgcgcggtatccgtaac
gactgcctgatcgtccacgcaattgacgatgaaacgtcgagcccgcgtaatccgcgcttc
gtcgcgtcatcgatcggctccgccttcttgcgcacgatctggctcgacgattcgtatcac
atgatcacatccgacaacgagcgcgagattgttgcgcgcgaaacggcattgtttctgcgc
gaaagcgaaatagcgagccgcacaggcgatgcgggcggcaagcccgtcgtttcgaaggcc
cttgcgcggcggcttcggcagcttgcggcaatgggcaaaggacgcgcgtaa

DBGET integrated database retrieval system