KEGG   Burkholderia phymatum: Bphy_5685Help
Entry
Bphy_5685         CDS       T00704                                 

Definition
D-cysteine desulfhydrase (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
bph  Burkholderia phymatum
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:bph00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Bphy_5685
Enzymes [BR:bph01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Bphy_5685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pBPHY01:175507..176520
Genome map
AA seq 337 aa AA seqDB search
MSIAPDLDLTAFSRYRLMEGPTPIQHLGRLSKLAGNVDIYVKRDDLMGLGGGGSKLRKLE
FLLGEALAQGADTIVTVGARQSNHARLTAAAAARAGLACEIVLTRTVPRDDNDYLHNGNV
LLDQLLGARIHDLPGHADAMAFAQHRAEDLRKSGRKVYLAPLGGSSAVGNLGYAACAAEL
LGQAREAGVSFDRIALPNGSGGTHAGLVAGLLSMGEDPARVVAYNVLATHESTLANTRLK
AQQTLELIQPAAILPISGVIVADGQRGDGYGIPTDAMREAVRLLASTEGLLLDPVYGGKA
FAGLLQDIRSQAFAPGSKVLFLMTGGLPGLYAYRSAF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcgcaccggatctcgatctcaccgcattttcccgctaccgcctgatggaaggt
cccacgccgatccagcacctcggccgcttgagcaagctggcgggcaacgtggatatctac
gtcaagcgcgacgacctgatgggcctcggcggtggcggcagcaaactcagaaagctcgag
ttcctgctaggcgaggcgctcgcgcaaggcgcagatacgatcgtcacggtcggtgcgcgc
cagtcgaatcacgcgcggctcacggcagcggcggcggcgcgagccggactcgcatgcgaa
atcgtgctgacccgcacggtgccgcgcgacgacaacgactaccttcacaatggcaacgtg
ctgctggaccaactgctcggcgcacgtattcatgatctgccgggccatgccgacgcgatg
gcgtttgcgcagcatcgcgcggaagatctgcgcaagtcgggacgcaaggtgtatctcgcg
ccgttgggcggctcgtccgcggtgggcaatctcggctatgcggcgtgtgcagccgagctt
ctcggacaggcgcgcgaagcgggggtctccttcgatcgcattgcgctgcccaatggcagc
ggcggcacgcacgcgggtctcgttgcggggctgctgtcgatgggcgaagatcccgcgcgc
gtggttgcctataacgtgctggcgacgcacgaaagtacgttggccaatacgcggctgaag
gcgcagcaaacgcttgagctgatccagccagcagcgattcttcccatctcgggcgtcatc
gtggcggacggccagcgaggcgacggatatggcattcccaccgacgcaatgcgtgaagcg
gtgcggcttctcgcgagcaccgaaggtctgctgctcgatcccgtgtacggcggcaaggcg
tttgcgggcttgctgcaagacatcagaagccaggcgtttgcgcctggctcgaaggtgctg
ttcctgatgacgggcggcttgcctgggctctacgcgtatcgcagcgcgttttga

DBGET integrated database retrieval system